KEGG   Desulfococcus multivorans: Dmul_38090Help
Entry
Dmul_38090        CDS       T04568                                 

Gene name
cat1
Definition
(GenBank) Cat1: predicted succinyl-CoA:acetate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
dml  Desulfococcus multivorans
Pathway
dml00020  Citrate cycle (TCA cycle)
dml00620  Pyruvate metabolism
dml00650  Butanoate metabolism
dml01100  Metabolic pathways
dml01110  Biosynthesis of secondary metabolites
dml01120  Microbial metabolism in diverse environments
dml01130  Biosynthesis of antibiotics
dml01200  Carbon metabolism
Module
dml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmul_38090 (cat1)
   00620 Pyruvate metabolism
    Dmul_38090 (cat1)
   00650 Butanoate metabolism
    Dmul_38090 (cat1)
Enzymes [BR:dml01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Dmul_38090 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF
Motif
Other DBs
NCBI-ProteinID: AOY60577
Position
complement(4288043..4289536)
Genome map
AA seq 497 aa AA seqDB search
MLRDRIRFKPLMDKITDADAACVHIQNGTNVFISGFTAGYPKLIPQALVRRAEKGERFRI
NLFAGASTGDAVDGVLAEAGLVSWRRPYMSNRTMRNRINADEIRFKDDHLSRLSSQVRDG
GWGRAHVAVVEAVAITRKGHLIPTMSVGNTPTYVREAEKIIIEISSEPPDLEGIHDIFIP
EDPPYRMPIPIYRSGDRIGKPFIEMDPQKVTAILFSREEDSCAVFTEPDTVSRRIAEHIL
DFVEHEIKRDRMPSFLPWQSGVGDVANAVLSGFLENDFFHTIDIYSEVLQDAVLDLIDMG
KVRAASGSAMTLSHKARTRFFNELYRYKEKIVLRPVEISNSPEVVRRLGVIAINTAIEVD
IYGHVNSTHVMGSHLMNGIGGSGDFLRNGALSFVVTPSTAKGGKISAVVPMVSHVDHNEH
SVDVIVTEHGLVDTRPLAPRQVAEAVIRKCAHPDYRDLLWDYYQRAVRGAGGHEPHILAE
AFGFHERFMATGDMHSR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttgagggatcggattcgcttcaagccgctcatggacaagattaccgatgcggatgcg
gcgtgtgttcacattcaaaacgggacaaatgtgtttatttcgggttttacggccgggtat
cccaaattgatccctcaggccctggtgcgacgggcggaaaagggagaacgcttcaggatc
aacctctttgccggggcctccaccggcgacgccgtcgacggcgtcctcgccgaggccggt
cttgtgagctggcgccggccctacatgagcaaccggaccatgcggaatcggatcaacgcc
gacgagatccgcttcaaggatgatcacctctcccgcctttcgtcgcaggtccgggacggc
ggctgggggcgggctcacgtagccgtcgttgaggctgtcgccatcacccggaaggggcac
ctgatccccaccatgtccgtgggaaacacccccacctatgtccgggaggcggaaaagatc
atcatcgagatttcctccgagccgccggacctggagggcatccacgatatcttcatccct
gaggacccgccgtaccgaatgcccatcccgatttaccggtcgggcgaccgtatcgggaaa
ccgttcatcgagatggaccctcaaaaggtgacggcgattctcttcagccgcgaagaggac
agctgcgcggtcttcaccgagcctgacaccgtttcacggcggattgcggagcacatcctt
gatttcgtcgagcacgaaatcaagcgggaccgtatgccgtcgtttctgccgtggcagtcc
ggggtcggggatgtcgcaaacgcggtgttgagcggatttctcgaaaacgatttcttccac
accatcgacatctattccgaggtgctccaggacgccgtcctcgatctcatcgacatgggc
aaggtccgggcggcctcggggtcggccatgaccctttcccacaaggcgcggacccggttt
ttcaacgaactctatcggtacaaggaaaagatcgttcttcgtccggtggagatttccaat
tcacccgaggtggtgcggcggttgggggtgatcgccatcaacacggccatcgaagtcgac
atttacggccacgtcaactccacccatgtcatggggtcccacctgatgaacggcatcggc
ggttcgggggactttctcagaaacggggcgctgtcgtttgtcgtcacccccagcacggcc
aaaggcggcaagatctccgccgttgtcccgatggtttcccatgtggatcacaatgaacac
tcggtggatgtgatcgtaaccgagcacggtctggtggacacccgacccctggcaccccgt
caggtagcggaggcggtgatcaggaaatgcgctcatccggattatcgcgatctgctctgg
gattactaccaacgggccgttcgcggtgccggcgggcatgaaccccatatactggccgaa
gcctttggtttccacgagcgcttcatggccacgggagacatgcattcccgctga

DBGET integrated database retrieval system