KEGG   Drosophila miranda: 108152955Help
Entry
108152955         CDS       T06132                                 

Definition
(RefSeq) titin homolog
  KO
K12567  titin [EC:2.7.11.1]
Organism
dmn  Drosophila miranda
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmn01001]
    108152955
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmn04131]
    108152955
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dmn04812]
    108152955
   04147 Exosome [BR:dmn04147]
    108152955
Enzymes [BR:dmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108152955
Protein kinases [BR:dmn01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108152955
Membrane trafficking [BR:dmn04131]
 Others
  Actin-binding proteins
   Others
    108152955
Cytoskeleton proteins [BR:dmn04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108152955
Exosome [BR:dmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108152955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig V-set
Motif
Other DBs
NCBI-GeneID: 108152955
NCBI-ProteinID: XP_017138144
Position
XR
AA seq 1460 aa AA seqDB search
MGNQPGKLHAHAQSGRPKKNVHWKSAERPSPPGRPILTPLSLLEQQPDVVNLRWDRPLLD
GGSPITGYTVEHRRMGSPHWVRATPTPVSRCDVCISGLEPGWRYQFRCFAENIVGRSDAS
ELSDPLTVTLQRNAITVPRFIDELLDTDAVEDERIEFRVRILGEPPPEINWFKDGYEIFS
SRRTKIVNDNDASVLIIHQVALTDEGEIKCTATNRAGHVVTKARLMVQAPPKIRLPRTYE
DGLIVEADEVLRLKVGIAGQPPPAISWLHEGEVIAPGGRFEVTNTEKNSLLKIDNVHRED
RGEYMVRAWNKLGEDNASFLVTVTARPNAPGAPRLNMSFGKSATLSWTAPLDDGGCKIGN
YIVEYFRIGWNVWLKAATTRALTTTLHDLIEGSEYKFRVKAENPYGLSEPSEESELLFIP
DPKRGITKPKSATKIAGEEKDKPKSDAVQVPPRRKTLSPPRPHADAATGMSPKQSPNAKR
KPKPQLIDNEQLHHEMSYGTSDQALRMDVRKSPSQSSADSSAKPAAGSNNKLNLTLITTT
ALVEKTEPLARPQKSPVGSPLKLFNTKPTAVAKERSPLQPQSQPLPTPPAEKPGKTVLHR
KRSLSPPTKRQHSETQPTSPPEPIKSTPALQRSAEPVQLGVNQNVRRFSGQALSPARNVP
TLALAVAASASAVIGERLPTIEISAPSPATATATATAPPPVPVPEESPKPKHKPKPDSSP
APRRTSRFADKHDEVHTSNEFMLVVFDKNSKVKDKDKQDSFELDLEDAIQPPPISISAPD
LAFLEFNNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQAAKSRKASQDRIASSTQAP
VPPANLRKRLGSISEAERVSFERRSELRRQSADMVSMGRKWDSRENVNDLSSLSRTHTTG
QISGEEQQRIREHEELDEEERTESTAEDSEDMNMEMDEDYPAQGKQQSSYDLGSDYTEST
ASSEQDSIEKFKMELLARTRSPSPRDLETYHPRNMGAGTFTPYRAPTPEQAAVVLNRPMP
LPSPDFVPKPILKRSSNEHVEQAVSPPNSPSLPGNGNGATATSAVGVAAIPQPSVPNAAP
NPSTSSLKMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLEKTNAAAIAADLEVKRRAK
EEEELRRLEAERLMQEEAHAAVDHYSDLVREVGSSHKYHTPLYLDREELKRAAAKAAAET
DEDEGSMSNTEEHRRRLASKTNDDMLLAPPVVSRERRLSISEREQLVHVRDASSNLAYHK
SRDKDELVREESEQQTQSQKEEEEPEYPTILVVPPLKTRNKTEAESESVMSETVEARPDA
RGRTRLVKVKRVIKRRVPSSTRSRETSLNRPPPPATGSLALAVERTSQTALVLSSAERDL
LERASALAVLQSEEHTHEKVRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQL
GEAVRGYIPTWLRRKGNDEA
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagccgggaaagctgcatgcccatgcacagagcggtcgacccaagaagaat
gtccactggaagtctgcagaacgaccatctccgcctggtcggcccatactgacgccgctg
tcgctcttggagcagcagcccgatgtggtcaacctgcgctgggatcgtccgctactcgac
ggaggctctccaatcaccggctacacggtggagcaccgtcgcatgggctcgccgcattgg
gtgcgtgccacacccacgcctgtctcccggtgcgatgtctgcatcagtggactggagcca
ggctggcgataccagtttcgctgctttgccgagaacatcgtgggacgatccgacgctagc
gagctctctgatcccctaacggttacactccagcgcaacgcgataactgttccccgcttt
atcgacgagctgttggacactgatgcggtggaggacgagcggatcgagttccgggtgcgc
atcctgggcgaaccgccgccggagatcaactggttcaaggatggctatgagatcttcagc
agtcgacgcaccaagatcgtcaacgacaacgacgccagtgttctgatcatccaccaagtg
gcactgacggacgaaggcgaaatcaagtgcacggcaacgaaccgagctggccacgtggtg
accaaagccaggcttatggtgcaggcgccacccaagattcgtttgccacgcacctacgag
gacggactcatcgtggaagccgacgaggtactgcgtctgaaggtcggcattgccggacag
ccgccgccggccatcagctggctccatgagggcgaagtgattgcccctggtggacgattc
gaggtcaccaatacggagaaaaattcgcttctcaagatagacaacgtgcatcgggaggac
cgtggcgaatacatggtgcgtgcatggaacaagctgggggaagacaacgcatcgtttctg
gtcacggtaacggcacggccgaatgctccgggtgctcctcgtctgaacatgtcgttcggc
aagtccgcaacgctctcctggacggcacctctggacgatggcggctgcaagatcggcaac
tacattgtggagtactttcgaattggctggaacgtctggctaaaggccgccaccacgcgg
gccctgacgaccactctgcacgatctgatagagggctcggagtacaagttccgcgtcaag
gctgagaacccctatggcctgagtgagccatccgaggagtcggagctgctcttcataccc
gatcccaagcgtggcatcaccaagcccaagtctgccaccaaaattgccggcgaggagaag
gataagcccaagtcggacgccgtccaagtaccgccacgccgcaagacgctctctccacca
cgtccccatgcagatgctgcgacgggcatgtcgcccaagcagtcgccaaacgccaaacgc
aagccaaagcctcagctcatcgacaatgagcagctgcaccatgaaatgtcctacggcacc
tcggaccaggctctaagaatggacgtccgcaagagcccctcccagagcagtgccgactcg
tcggccaagccggcggctggatccaataacaagctcaacctcacgctgatcaccacaacc
gctctggtcgagaagacagagcccctggctaggccccagaagtcgccagttggctcacct
ctcaagttgttcaataccaagcccacggctgtggccaaagagaggtccccactgcagccc
caatcacagcccctgcccactccgcctgcggaaaagccgggtaaaacggtcctccaccga
aaacgaagtctgagtccgccaacgaagcgacaacactccgaaacgcaaccaacatcacca
ccggagcccatcaagtcaactccagccctgcagcgtagtgcggagcctgtccagctgggg
gttaaccagaatgtgagacgattctcgggccaggccctgagtccggcgaggaacgtaccc
accctggcattggcagtggctgccagtgctagtgcggtgattggcgaaaggctgcccacc
attgagatcagtgcaccatcaccagccacagcaacagcaacagccacagctccgcctcca
gttccagttccggaagagtcccccaaaccgaaacacaagcccaaaccagactcttctcca
gctccgagacgtacctccaggtttgcggacaagcacgatgaggtgcacaccagcaacgag
ttcatgctcgtcgtcttcgacaagaacagcaaggtcaaggataaggacaagcaagattcc
ttcgagctagacctggaggatgccatacagccaccgcccatatccatctccgcaccagat
ctggcatttctggagttcaacaacctgcataccacctttccgctgcgccggtccgtgagc
tccaccgagctgctctacgagcgagcaatggcgagattctatgaggcggtagagctggag
caagccgccaagtcgagaaaggcctctcaggacagaatagcaagcagtacgcaggcgcct
gttccgccggctaatctccgcaagcgcctgggctccatttcagaggcagagcgcgtgtcg
ttcgagcggaggagcgaactgcgtcggcaatcagcggacatggttagcatgggtcgaaag
tgggactcaagggagaatgtcaacgatctgagcagcctctcacgcacgcacactacggga
cagatttcgggcgaggaacagcagcgcatccgggaacacgaagagcttgacgaagaagag
cggaccgagagcacagcagaagacagtgaagacatgaatatggagatggatgaggactat
ccagcacagggtaaacagcagtctagctacgatctgggatccgactacaccgagagcact
gcctcctcggagcaggactccattgagaagttcaagatggaactgctggctcgcactcgc
tcgcccagcccccgcgatctggagacgtaccatcctcggaacatgggcgctggcaccttt
acaccctatcgcgcccccacaccggagcaggcagctgttgtgctcaaccgccctatgcct
ctgcccagtccagactttgtccccaagccgatccttaaacgctcgtccaacgagcatgtg
gagcaggcggtgagcccacccaacagtccatccttgcctggaaatggcaatggagccaca
gccacctccgcagtgggagttgcagccatcccacagccatccgtaccaaatgctgcgccc
aatcccagcaccagcagcctaaagatggacctggccaaaggcataaagtcgttctttagt
cgcgacaagcgatccgccaccgagaagaacactgaagccaacgaggagatatcgaatcct
ctggagaaaaccaatgccgctgccattgcggctgatttggaggtcaaacgcagggccaag
gaggaagaggaactacgtcgcctagaggccgagcgcctcatgcaggaggaggcccatgcc
gccgtcgatcactacagcgacctagtccgggaggtgggcagctcccacaaataccacacg
ccactctacttggaccgcgaggagctgaagcgggccgccgccaaggcagcagccgaaact
gacgaggatgagggatccatgtcaaacacggaggaacacaggaggcggctggctagcaag
accaacgacgacatgctgttggcacccccagtggtcagtcgggagcggcgtctgtccatc
tcggagagggagcagctggtgcatgtccgtgatgcgtccagtaatctggcgtatcacaaa
tcacgcgacaaagatgagttagtgcgggaggagagcgagcagcagactcaaagccagaag
gaagaggaggagccggagtacccgactatcctagtggtgccccctcttaaaacaaggaac
aagacggaggcggagagtgagagcgtcatgagcgagacggtcgaggctcgtcccgatgcc
cggggacgaactcgtctcgtaaaggtaaagcgggtgattaagcggcgggttccgtccagc
actcggtctcgcgaaacctcgctcaatagacccccaccaccagctacgggaagcctggct
ctggcagtagagaggacctcacagacggccctggttctgtcaagcgccgagcgggatctt
ctggagagagcgtccgcactggcggtgctccaatcggaggagcatacgcacgagaaggtc
cgctcggctctcagctactgtacggatctggttctcttcctggttgcctgttatgtgtac
ttgttcaaggacgcgagactggtcctgccaatcctgggtctgatcatttaccgccaactg
ggcgaagccgtaaggggctatatacccacctggttgcgtcgcaagggcaacgacgaggcc
tga

DBGET integrated database retrieval system