KEGG   Drosophila miranda: 108156671Help
Entry
108156671         CDS       T06132                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dmn  Drosophila miranda
Pathway
dmn03040  Spliceosome
dmn04141  Protein processing in endoplasmic reticulum
dmn04144  Endocytosis
dmn04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108156671
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108156671
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108156671
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108156671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dmn01009]
    108156671
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dmn03041]
    108156671
   03009 Ribosome biogenesis [BR:dmn03009]
    108156671
   03110 Chaperones and folding catalysts [BR:dmn03110]
    108156671
   04131 Membrane trafficking [BR:dmn04131]
    108156671
   03051 Proteasome [BR:dmn03051]
    108156671
   03029 Mitochondrial biogenesis [BR:dmn03029]
    108156671
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmn04147]
    108156671
Protein phosphatases and associated proteins [BR:dmn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108156671
Spliceosome [BR:dmn03041]
 Complex B
  Other components
   Prp19 complex
    108156671
 Complex C
   Prp19-CDC5 complex
    108156671
Ribosome biogenesis [BR:dmn03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108156671
Chaperones and folding catalysts [BR:dmn03110]
 Heat shock proteins
  HSP70 / DNAK
   108156671
Membrane trafficking [BR:dmn04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108156671
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108156671
Proteasome [BR:dmn03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108156671
Mitochondrial biogenesis [BR:dmn03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108156671
Exosome [BR:dmn04147]
 Exosomal proteins
  Proteins found in most exosomes
   108156671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 108156671
NCBI-ProteinID: XP_017143783
Position
2
AA seq 634 aa AA seqDB search
MAKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNDTERLIGDAAKNQVA
MNAKNTVFDAKRLIGRKFDDKKIQEDLKHWPFKVVNDGGKPKIEIEFKGERKRFAPEEIS
SMVLTKMREIAELYLGGKVKDAVITVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAA
LAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVN
HFMEEFKRKYKADIKGNVRALRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKISR
ARFEELNMDLFRSTMQPVERALSDAKMDKKSIHDVVLVGGSTRIPKIQRLLQDLFGGKQL
NLSINPDEAVAYGAAVQAAILTGVGSSKIQDLLLVDVAPLSLGIETAGGVMTKLVERNAR
IPCKQQQTFTTYSDNQNAVTIQVFEGERAMTKDNNLLGTFNLNGIPPAPRGVPQIDVTFD
LNADGILNVAAKDHSSGRSEKITITNDKGRLSKAEIDRMLSDAEKYKDEDEKQRERVQAR
NTLEGYLYGCKQAVEEAASGVLSDADRTTVRDKCSSEMAWLDKNTLAEKEEYEHHIKDTQ
RVCSPIMTKLHGGAGQKGKQQTGNGTGPTVEEVD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggccaagataccggcaatcggaatcgatttgggaaccacctactcctgcgtgggagtg
tggcagaacagcaaggtggagatcatagccaacgaccagggcaaccggacgaccccctcc
tatgtggcattcaacgacacggagcgcctgattggcgatgcggccaagaaccaggttgcc
atgaacgccaagaatacggtcttcgatgcgaaacgactgattggccgcaagttcgacgac
aagaagatccaggaggacctcaagcactggcccttcaaagtcgttaacgacgggggtaag
cccaaaattgagatcgagttcaagggcgagcgcaagcgctttgcccccgaggagatcagc
tcgatggtcctgaccaagatgcgcgagattgccgaactatatctgggtggcaaggtgaag
gatgccgtcatcacagtgccggcctacttcaacgacagccagcggcaggcgaccaaagat
gccggctccattgccggtctcaacgtgctcagaataatcaacgagcccacggccgctgcc
ttggcgtacggtctggacaagaatctgaagggcgaacgcaacgttctcatattcgatttg
ggcggcggcaccttcgacgtgtccattctgaccatcgacgaggggtcgctgtttgaggtc
aaggccacggccggcgacacccatctgggcggcgaggacttcgacaaccgtctggtcaac
cacttcatggaggagttcaagcgcaagtacaaggccgacatcaagggcaatgtgcgggcc
cttcgccgcctgcgcactgcctgcgagcgggccaagcgcacgctgtcctccagcacggag
gcctccttggagatagatgccttgcacgagggcattgacttctattcgaagatttcgcgt
gcccgcttcgaggagctgaatatggacctgttccgctcgaccatgcagccagtggagcgt
gcgctcagcgatgccaagatggacaagaagtccatccacgatgtggtcctggtgggcggc
tccacgcgtattcccaagatacagcgcctcctgcaggacctatttggaggcaagcagttg
aacttgtccatcaatcccgacgaggccgtggcctatggcgccgcagtgcaggctgccatc
ctcacgggggtcggcagctccaagatccaggatctgcttctggtggacgtggctccactc
tccctcggcatcgagacggccggcggagtgatgaccaagctggtggagcgtaacgcccgg
attccctgcaagcagcagcagaccttcaccacctacagcgacaaccagaacgccgtgacc
atccaggtgttcgagggcgagcgtgccatgaccaaggacaacaatctcttgggcaccttc
aacctaaacggcattccgccggctccacgtggcgtgccccagattgatgtgacctttgac
ctgaacgccgatggcattctgaatgtcgccgccaaggaccacagctccggcaggtccgag
aagatcactatcaccaacgacaagggtcgtctgtccaaggccgaaatcgaccgcatgctc
tccgatgccgagaaatacaaggacgaggacgaaaagcagcgcgagcgggtccaggcccgc
aacactctcgagggatacctctacggatgcaagcaggcggttgaggaggcggcctctggg
gtcctctccgatgccgatcgcaccacggtgcgcgacaagtgctcctccgagatggcctgg
ctggacaagaacacgctggccgagaaggaagagtacgagcaccacataaaggacacccaa
cgcgtgtgcagtcccattatgaccaagttgcatggcggcgccggtcagaaaggcaaacag
cagactggcaatggcaccggacccaccgtggaagaggttgactaa

DBGET integrated database retrieval system