KEGG   Drosophila miranda: 108159007Help
Entry
108159007         CDS       T06132                                 

Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
dmn  Drosophila miranda
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dmn03011]
    108159007
Ribosome [BR:dmn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    108159007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 108159007
NCBI-ProteinID: XP_017147370
Position
3
AA seq 152 aa AA seqDB search
MSVPFSGTLRRSGGIVSAIGKQLKSINLKGVKRITVQFDPFAENVKSTREFFFLLSTPKV
IQTNPKCVVKSDIVCDRQAASIKFALIDSAQEQAKVKEIRFNSGNLNTLELLELCNKHVS
SLAPPEEVTNKVLTKAEKQKLGGDSKKALKKK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgccatttagtggcactcttcgacgttcgggtggcattgtttcggccatcgga
aagcagctgaaaagcatcaacctaaaaggcgtcaaacgcatcacagtccaatttgatccg
tttgcggaaaatgtcaagtctacccgcgaattcttcttcctgctctccacacccaaggtg
atccagacaaatcccaagtgcgtggtcaagtcggatattgtgtgtgaccgtcaggcggct
tcgataaaatttgccctcattgattcggcgcaagaacaagctaaagtaaaggagatccgc
ttcaacagtggcaacctgaacaccctcgagttactggagctttgcaacaaacacgtctcc
agcttggccccacccgaggaggtgaccaacaaggtactgaccaaggcagagaaacagaag
ctgggcggcgacagcaagaaggcgttgaagaagaaataa

DBGET integrated database retrieval system