KEGG   Drosophila miranda: 108159259Help
Entry
108159259         CDS       T06132                                 

Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
dmn  Drosophila miranda
Pathway
dmn04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108159259
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmn01001]
    108159259
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dmn03036]
    108159259
Enzymes [BR:dmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108159259
Protein kinases [BR:dmn01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   108159259
Chromosome and associated proteins [BR:dmn03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108159259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Kinase-like PH C1_1 ZapB Pkinase_C C1_2
Motif
Other DBs
NCBI-GeneID: 108159259
NCBI-ProteinID: XP_017147892
Position
XL
AA seq 1378 aa AA seqDB search
MDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHDTLKRLKNIEQYAAKYKPL
AQRINQLRMNVEDFDFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFW
EERHIMAHANSEWIVQLHFAFQDSKYLYMVMDFMPGGDIVSLMGDYDIPEKWAIFYTMEV
VLALDTIHNMGFVHRDVKPDNMLLDNYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYIS
PEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPQE
VEISEQAKALIRAFLTDRTQRLGRYGIDDIKAHPFFRNDTWSFDNIRESVPPVVPELTSD
DDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAEAKEPNSVN
SNASNNHAHGHGHNHRHRTSNSNELKRLEALLERERGRADALEKQDTSLRHKIELSGKRE
VELQRIAAEYEKDLAQRKNNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRTRDL
NISEKVVSLEKLLQEMEHSYKSETENTQKLKKQNAELGFTLKTQEEKVRDMVDMIDTLQK
HKEELGQENADLQAQVVQEKNMRSQLKELHKETENKMQTLTNDIERTLVREQKAKEDNRV
LLERISELEMSHASLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQEVKALQSKLN
EEKSARIKADQNWQEKERQLNMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQEHS
KRNGLLSELSLLSSEVAHLRSRENQLQKELSTQREAKRRFEEDLSQLKGTHHEALANNRE
LQEQLDAELCFSRLYKTQANENREESAERLAKIEDLEEERVSLKHQVQVAVARADSEALA
RSIAEETVADLEKEKTIKELELKDFIMKHRNEINAKEATLATLKEAETELHKKLGQMANE
YEDLVQQHKKQQDELGQLLATKDEEITKLLEKCKTEVLLKQVAVNKLAEVMNRRDSDLQK
QKSKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKHQDLQQLCAEEQQHKQKMVMEI
DCKATEIEHLQSKLNETASLSSADNDPEDSQHSSLLSLTQDSVFEGWLSVPNKQNRRRGH
GWKRQYVIVSSRKIIFYNSDIDKHNTTDAVLILDLSKVYHVRSVTQGDVIRADAKEIPRI
FQLLYAGEGASHRPDEQSQLDVSVLHGNSNEERPGTIIHKGHEFVHITYHMPTACEVCPR
PLWHMFKPPAAYECKRCRNKIHKEHVDKHDPLAPCKLNHDPRCARDMLLLASTPEEQSLW
VARLLKRIQKSGYKANSSNNNSTDGSKISPSQSTRSSYKPFVANVQRSATLPANSSLK
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggaaaggcggcgtcgagcgaatacgctcgagcgcgagatgcgcgatccgacc
agcatttgcaatgtggactgcctgctggatacggtatcggccctggtcagcgactgcgac
cacgacaccctcaagcggctgaaaaacatcgaacagtatgctgccaaatataaacccctg
gcgcagaggatcaatcagctgcgcatgaatgtcgaggacttcgacttcattaagctaatc
ggcgccggggcctttggagaggtgcaactggtgcggcacaagtcctccagccaggtgtac
gccatgaagcggctgtcgaaatttgagatgatgaagcgcccggactcggccttcttctgg
gaggaacgtcacattatggcccatgccaactccgagtggattgtccaactgcatttcgca
tttcaggactccaaatacctgtacatggtgatggactttatgcccggcggtgacatcgtc
tcgctgatgggggactacgatatacccgaaaaatgggccattttctacacaatggaggtg
gtgctggccctggacaccattcacaacatgggctttgtgcaccgtgacgtgaagccggac
aacatgctgctcgacaattacgggcatctgaagctcgccgatttcggcacctgcatgcgc
atgggcgccaacggccaggtggtgtccagcaatgcggtcggcacgccggactacatcagt
ccggaggtgctgcagtcgcagggtgtcgacaatgagtatggccgcgagtgcgactggtgg
tcggtggggatcttcctctacgagatgctcttcggggagacgcccttctacgcggactca
ctggtgggcacctacggcaagatcatggaccacaagaactcgctcagcttcccccaggag
gtggagatcagcgaacaggccaaggccctgatccgggcattcctcacagatcggacgcag
cgtctgggccgctacggcatcgatgatatcaaggcgcatccgttcttcagaaacgacacc
tggtcctttgacaatatcagggagagtgtgccgccggttgtgccggagctaacctcggac
gacgatacgcgcaactttgaggacatcgagagggacgaaaagcccgaggaggtgttcccc
gtaccgaagggcttcgatggcaatcacctgcccttcatcggcttcacctacacgggcgac
taccagctcctgtccagcgacaccgtcgacgccgaggccaaggagcccaattcggtgaac
agcaacgccagcaacaaccatgcccacggccatgggcacaaccatcgccatcgtacctcc
aactccaacgagctgaagcggctcgaggcactgctcgagagggagcgcggccgagccgat
gctctggagaagcaggacaccagcctgcggcacaagatcgagctgagcggcaagcgtgag
gtcgaactgcagcgcattgcggccgagtacgagaaggatctggcgcagcgaaagaacaac
tacaaggtggccatgcagaaggtggagcaggagatcgagctgcgcaagaagacggaggcc
ctgctggtggagacgcagcgcaatctggagaacgagcagaagacgcgcacacgcgatctc
aacatcagcgagaaggtcgtctcgctggagaagcttctgcaggagatggagcacagctac
aagagcgagacggagaacacacagaagctgaagaagcagaacgcggagctcggcttcaca
ctgaagacgcaggaggagaaggtgcgcgacatggtcgacatgatcgacacactgcagaag
cacaaggaggagctgggccaggagaatgccgatctgcaggcgcaggtggtgcaggagaag
aacatgcgctcccagctgaaggagctgcataaggagacggagaacaagatgcagaccctc
accaatgacattgagcgcaccttggtccgcgagcagaaggccaaagaggataaccgcgtg
ctgctggagaggatcagtgagctggagatgagccatgcaagtctcgactttgagctgaag
gcggcccagggtcgctaccagcaggaggtcaaggcccaccaagagactgaaaagtcgcga
ctggtctctcgcgaggaggcgaatctgcaggaggtcaaggccctgcagtccaagctgaac
gaggagaagtccgcccggatcaaggcggaccagaactggcaggagaaggagcgccagctg
aacatgctctccgtggactaccgccagatccagctgcggctgcagaagctggagggcgag
tgccgccaggaatcggagaaggtggccgccctccagtcgcagctggaccaggagcacagc
aaacgcaacggcctgctctcggagctcagtctgctcagctcggaggtggcgcatctgcgc
tcccgcgagaatcagctgcagaaagagctctccacgcagcgcgaggccaagcggcgcttc
gaggaggacctgtcgcagctgaagggcacccaccacgaggccctcgccaacaatcgggag
ctgcaggagcagctggatgccgagctgtgcttctcccggctgtacaagacgcaggccaac
gagaatcgggaggagagcgccgagcgtttggccaagatcgaggatctggaggaggaacgc
gtctcgctcaagcaccaagtgcaagtggccgtcgctcgggccgactcggaggccctggcc
cgctcgatagccgaggaaacggtggccgatcttgagaaggagaagaccatcaaggagctg
gaactgaaggacttcatcatgaagcaccgcaacgagatcaatgccaaggaggcgacgctc
gccaccctcaaggaggcggagacagagctgcacaagaagctcggccagatggccaacgag
tacgaggatctcgtccagcagcacaagaagcagcaggacgagctgggccagctgctcgcc
accaaggacgaggagatcaccaagctgctggagaaatgcaagaccgaggtgttgctcaag
caggtggccgtcaacaagctggccgaggtgatgaaccgacgcgactcggacttgcagaag
caaaagagcaaggcccggtccacggccgagctgcgcaagaaggagaaggagatgcgccgc
ctgcagcaggagctgtcccaggagcgtgacaaattcaatcagctgctgctcaagcaccag
gacctgcagcagctgtgcgccgaggagcagcagcacaagcagaagatggtcatggagatt
gactgcaaggccaccgagattgagcatctccagagcaagctgaacgagacggcctcgctc
tcatccgccgacaacgatcccgaggacagtcagcactcctctctgctctccctcacacag
gactcggtcttcgagggctggctgagtgtcccaaacaagcagaaccgtcggcgcggccac
ggctggaagcgccagtatgtgattgtctcctcgcgcaagatcatcttctacaactcggac
atcgacaagcacaacacgacggacgctgtgctcatactggatctgagcaaggtataccac
gtgcgcagcgtcacccagggcgatgtcatacgcgccgatgccaaagagattccgcgcatc
tttcagttgctgtatgccggcgagggcgcctctcatcgtccggacgagcagagccagctg
gatgtgagcgtgctgcatggcaacagcaacgaggagcgtcccggcaccatcatccacaag
ggtcatgaatttgtgcacatcacctaccacatgcccacagcgtgcgaggtgtgcccgagg
ccattgtggcacatgttcaagccgccggcggcttacgaatgcaagagatgccgcaacaag
atacacaaggagcatgtggacaagcatgatccgctggcgccctgcaagctcaatcatgat
ccgcgctgtgcccgcgatatgctgctgctggcctccacgcccgaggagcaatcgctgtgg
gtggcccgtctgctgaagcgtatccaaaagagtggatacaaggcgaattcgtcaaacaac
aacagcaccgatggcagcaagatatcgcccagccaatcgacccgctcctcctacaagccg
tttgttgcgaacgtgcaacgctccgccacgctaccagccaactcatcgctgaaatga

DBGET integrated database retrieval system