KEGG   Drosophila miranda: 108159351Help
Entry
108159351         CDS       T06132                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dmn  Drosophila miranda
Pathway
dmn03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108159351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dmn03041]
    108159351
Enzymes [BR:dmn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108159351
Spliceosome [BR:dmn03041]
 Complex C
  Other components
   Step II factors
    108159351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE Flavi_DEAD AAA_30 AAA
Motif
Other DBs
NCBI-GeneID: 108159351
NCBI-ProteinID: XP_017148048
Position
3
AA seq 1254 aa AA seqDB search
MEELQQLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNQSYDAFRKALLENGAEFP
DSLVQNLQRIINLMRPSRPRGGSEEKIGSGSSKDDKKSQLMKMFPGLALPNDKYSQSEGQ
DEEAMEKHSVGKKTDLSDVDAAMMELEALAPGEGKTEDKKEIKESRERPHKRRERSRSRE
KDRDTRKRSRSREDRNRERRRSKSRDDRHRERRRSRSRDKERRRRSRSREHRDRERERRR
SRSRDDRERDRGRRRSSSRDRHERRQRSRSRSGDRGDRRQDKMPPPSTVMADDPEAGKIY
SGKVANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVVRNQTVRVKVMSLTG
QKVSLSMKEVDQESGRDLNPLSHTPEDDDLLRDRNPDGPFSSSTSMLNLQGNSLDGDENE
SRKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEADIEIEIVEEEPP
FLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEMEALPTNLNK
NWIDPLPEEDTRNLAANMRGMGAAPAEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPI
YKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVA
KRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKTYSVIMLDEA
HERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVL
YTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPEL
IILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNS
KTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLAT
TVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEP
NLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLA
VYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKSSVRIQKAV
CSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTT
IDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgcagcaattggagtatctgtcgctggtctcgaagatctgcacagagctc
gataatcacttgggcatcaatgacaaggacctggccgagttcatcatcgatttggagaac
aagaatcaatcgtacgatgccttccgcaaggctctgctcgagaacggcgccgagtttcca
gactccctcgtccaaaatctgcagcgcatcatcaacttaatgcggcccagtcggccgaga
ggcggaagcgaagagaagatcggctccggcagcagcaaagatgacaagaaatcgcagctg
atgaaaatgttccctggcctggccctgcccaacgataaatacagccagagcgagggccag
gacgaggaagccatggaaaagcattcggttggcaaaaagacagacctgagtgacgtggac
gcggccatgatggagcttgaggctctggcgcctggcgagggcaagaccgaggataagaaa
gagattaaggaatcgagagaacgaccccacaagcgaagggaacgcagcagaagtcgcgag
aaggacagggatactcggaagcggagcagatctcgcgaggataggaatagggagcgccgc
aggagcaagtcacgcgatgaccggcatagggagcgtcgcaggagtagatctcgtgacaaa
gaacgccgcagacgcagcagatcacgcgagcatcgcgatcgggaacgggaacgccgccga
agcaggtcccgcgacgatcgcgagcgagatcgtggtcgccgcaggtccagctctcgagac
cgccacgagcgtcgacaacgcagtcggtcgcgctcaggcgatcgtggtgatcgccgtcag
gacaaaatgccgccccccagcacagtgatggccgacgatcccgaggctggcaagatctac
tccggcaaggtggccaacattgtgcccttcgggtgctttgtccagctcttcggactgcgc
aagcgctgggaggggctggtgcacatctcgcagctgcgagccgagggcagggtcaccgac
gtgaccgaagtggtggtccgcaatcagaccgtgagggtcaaggtgatgtcactgacgggt
cagaaagtgtcgctgtccatgaaggaggtcgatcaggagtcgggcagggacttgaatccc
ctctcgcacacccccgaggatgatgacttgctgcgggaccgcaatccagatggtcccttc
agcagcagcacctccatgctaaatctgcagggcaacagcctggacggggacgagaacgag
tcaaggaagcgggttaccaggatctccagccccgagcgatgggaaatcaaacagatgatt
agctctggggtcctggacaggagcgaaatgccggactttgacgaggagacaggtctgctg
cccaaggacgaggacgacgaggcagacatcgagattgagattgtggaggaagagccgcca
ttcctctcaggccatggcagggccctgcacgacctatcgcccgtgagaattgtcaagaat
cccgacggttcgttggcccaggcggccatgatgcagtcggccctgtccaaggagcggcgg
gagcagaaaatgctgcagcgcgaacaagaaatggaggccctgcccacgaacctcaacaag
aactggatcgatccgctgcccgaggaggacactcgcaatctggcggccaacatgcgtggc
atgggcgccgcccccgccgaggtgcccgagtggaagaagcacgtgattggcggcaagaag
tcatcctttggcaagaagacggacctcaccttggtcgagcagcgccagtcgctgcccata
tacaagctgcgcgatgatctgatcaaggccgtcaccgacaatcaaatcctgatcgtcatc
ggcgagacgggctccggcaagaccacacagataacccagtatctgggcgagtgcggattc
acggcacgcggcaagatcggttgcacgcagccgcgtcgtgtggccgccatgtccgtggcc
aagcgagtggccgaggagtacggttgccggctgggccaggaggtgggctacaccatccgt
ttcgaggactgcaccagcccggagacgatcatcaagtacatgacggacggcatgttgctg
cgcgagtgcctgatggaggcggagctgaagacctactcggtgatcatgttggacgaggcc
cacgagcgcaccatccacacggacgttctctttggcctgctgaagaccgccgtacagaag
cgtcccgaactgaagctgatcgtgacctccgcgaccctggatgctgtgaagttctcgcag
tatttcttcaaggctcccatatttacgattcccggacgaacgttccccgtggaggtgctg
tacacaaaagagccggaaacagattatctggatgcctcgctgatcacagtgatgcagatc
catctgcgtgagccgcccggcgacattctgctcttccttaccggccaggaggaaatcgac
acggcctgcgagatcctctacgagcgcatgaagagcctcggacccgatgtacccgaactg
ataatactccccgtctactcggcgcttccctccgagatgcagacgcgcatcttcgatccg
gcccccgccggcagccgcaaagtggtgatagccaccaacattgcggagacctcgctgacc
attgacggtatattctatgtggtggatccaggatttgtcaagcagaaagtgtacaactcc
aagactggcatggactctctggtggtgacgcccatctcccaggcagctgccaagcaaagg
gccggccgtgccggacgcacgggtccgggcaaaacctatcgtctgtacacggagcgcgcc
taccgggatgagatgctacccacgcccgtcccagaaattcagcgcacgaatctggccacc
acagtgctccagctgaagacgatgggcatcaacgatctgctgcactttgacttcatggat
gccccgcccgtggagtcgctggtgatggccctcgagcagttgcattcgctgtccgcgctg
gatgatgagggattgctaacgaggctgggtcggcgcatggccgagttccccctggagccg
aatctctcgaagatgctcatcatgtctgtggctctgcagtgctcggatgagatactcacc
atcgtctcgatgctgagtgtccagaatgtgttctacaggcccaaggacaagcaggcccta
gccgatcagaagaaggccaagttcaaccaggccgagggcgatcatcttaccctcttggcc
gtttacaacagctggaagaacaacaagttctcgaatgcctggtgctacgagaactttgtc
cagatccggacactcaaacggtcgcaggatgtgaggaagcagctgctgggcatcatggat
aggcataagctggacgtggtatcggcgggcaagagctcggtgcgcatccagaaggccgtc
tgctcaggctttttccgcaatgcggccaaaaaggatccacaggagggctaccgtaccctg
gtcgactcgcaggtggtgtacattcatccatcgagcgctctgttcaatcgacagccagag
tgggtcatctatcacgaactggtgcagaccaccaaggagtatatgcgcgaggtgaccacc
atcgatcccaagtggctggtggagtttgccccgtccttcttccgcttctcggaccccacc
aagctgagcaaattcaagaagaaccagcgcctggagccgctctacaacaagtacgaggag
ccgaacgcatggcgcatatcgcgcgtgcggcggcgtcgcaactaa

DBGET integrated database retrieval system