KEGG   Drosophila miranda: 108162242Help
Entry
108162242         CDS       T06132                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dmn  Drosophila miranda
Pathway
dmn00480  Glutathione metabolism
dmn00980  Metabolism of xenobiotics by cytochrome P450
dmn00982  Drug metabolism - cytochrome P450
dmn00983  Drug metabolism - other enzymes
dmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108162242
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108162242
   00982 Drug metabolism - cytochrome P450
    108162242
   00983 Drug metabolism - other enzymes
    108162242
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dmn02000]
    108162242
Enzymes [BR:dmn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108162242
Transporters [BR:dmn02000]
 Other transporters
  Pores ion channels [TC:1]
   108162242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 108162242
NCBI-ProteinID: XP_017152371
Position
XL
AA seq 152 aa AA seqDB search
MAGVVELLSLNNPVFKSYVFWAGVLVIKMLLMSLLTAVQRFKTKTFANPEDLMSPKLKVK
FDDPNVERVRRAHRNDLENIVPFFIIGLLYTLTNPSVFLAVNLFRAVGIARIVHTIVYAV
VVVPQPSRALAFFVALGATVYMALQVILAAAF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgttgtggagctactcagccttaataatcccgtgttcaagagctatgtgttc
tgggccggcgttctggtcatcaaaatgctgctcatgagcctcctcacggccgtgcagcgc
ttcaagacgaagacctttgccaatcccgaggatctgatgtcgcccaagctgaaggtcaaa
ttcgacgatcccaatgtggaacgtgtgcgccgcgcccatcgcaacgatctggagaacatt
gtgccctttttcatcatcggcctgctctatacgctgacgaatcccagcgtcttcctggcc
gtcaatctcttccgcgccgtgggcattgcccgcattgtccacaccatcgtctatgctgtg
gtcgtggtgccacagccatcccgcgcgctcgctttctttgtggccctcggtgccaccgtg
tacatggccctacaggtcatcctggcggctgctttttaa

DBGET integrated database retrieval system