KEGG   Drosophila mojavensis: Dmoj_GI10359Help
Entry
Dmoj_GI10359      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6 NQRA_SLBB Abhydrolase_1 Lipase_2
Motif
Other DBs
NCBI-GeneID: 6574628
NCBI-ProteinID: XP_002000662
FlyBase: FBgn0133123
UniProt: B4K4X0
Position
Unknown
AA seq 438 aa AA seqDB search
MATQGPAVQGKVTNEVESAVMRAKAAAERLQLNANEKSKASHAGMQIVRTSNQDISSMNL
MTPAVLPISERHNFENNNNNNNSNTDKNSTGPMVGDEQLLRLQDYNLLYNAERQTYFQLH
SSSRRGPSGLSYGNRLLQQYVGNKLSAAFGLNVNDGKESIMQLTTQTVRLYDAASLRQSH
FNPFQPTRIIIHGWLGNAHANVYNYLVPAYLKLSDGSYNIFTVDWGRGAIADYITASYRV
KPVGQVLAKFLDFLHVEAGMQFEDLQLIGFSMGAHIAGLAAKHVQTGHVRVIRALDPALP
FFRYAQEKERLSRNDASYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWR
AFALFKESLEGTVFEARGCQPSEWQQLTRHKRCPQPTGSRLHMGGDLGTLSMEQLAQREG
VYYFETQARPPYDMGPAT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaaggacccgcagtgcaaggaaaagtgacaaatgaagtggaaagtgccgtg
atgagggcgaaagcagcagccgaaagactgcagctaaatgcaaatgaaaagagcaaggcc
agtcatgcaggcatgcaaatcgtaaggacatctaaccaggacatcagcagcatgaactta
atgacacccgctgtgttgccaatatcggaaagacataatttcgaaaacaacaacaacaac
aacaacagcaacactgacaaaaactcgactggcccaatggtcggtgatgagcaactatta
cgattgcaggactacaatttactatacaatgccgagcgacagacctactttcagctgcat
tcgagcagtaggcgtggcccgagcggactatcgtatggtaatcgcctgctgcagcagtac
gttggcaacaagctgagcgctgccttcggcctgaatgtcaacgacggcaaggagtcaatc
atgcagctgaccacgcagacggtgcggctctacgatgccgcttcgctgcgccaatcacac
ttcaatcccttccagcccacgcgaatcataatccatggctggctgggcaatgcacatgcc
aatgtctacaattacttggtgcccgcgtacctgaagctcagcgatggcagctacaatatt
ttcactgtcgactggggacgtggtgccatcgccgattatataacggccagctatagagtg
aagccagtgggtcaggtgctggccaagtttctggactttctgcacgtggaggcgggcatg
cagtttgaggatctgcagctgattggcttcagcatgggcgcccatattgccgggctggcc
gccaagcacgtgcagaccggtcatgtgcgtgtgatacgcgccttggatccggccctgccc
ttctttcgctacgcccaagagaaggagcgcctcagccgcaacgatgccagctacgttgag
gtgctgcacacgagcgtgggcagctacggattcgatcgtccgctgggccacgtagacttc
tacgccaactggggtagccagcagccgggctgcttctggcacgaatgcagccactggcgt
gcctttgccctattcaaggagagcctggaggggacggtcttcgaggccaggggctgtcag
ccaagcgaatggcagcagttgacgcgccacaaacgctgcccgcagccaacgggcagccgg
ctccacatgggcggagatttgggcacactatccatggagcagctggcgcagcgcgaggga
gtttattatttcgagacccaggcgagaccgccctatgatatggggccagcgacatag

DBGET integrated database retrieval system