KEGG   Drosophila mojavensis: Dmoj_GI10668
Entry
Dmoj_GI10668      CDS       T01062                                 

Name
(GenBank) uncharacterized protein
  KO
K13763  cGMP-specific 3',5'-cyclic phosphodiesterase, invertebrate [EC:3.1.4.35]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00230  Purine metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmoj_GI10668
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     Dmoj_GI10668
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD
Other DBs
NCBI-ProteinID: EDW16674
FlyBase: FBgn0133432
UniProt: B4K9L4
AA seq 921 aa
MEHNKSPRKLSNSSVHALPESRRHLMELDEGELFMELIRDVANELDIDVLCHKILVNVGL
LTHADRGSLFLAKGTPNNRYLVAKLFDVTQTTALKDAVTRARAEEIIIPFGIGIAGMVAQ
TKQMINIKEAYKDARFNCEIDLKTGYTTNAILCMPICNYEGDIIGVAQIINKTNGCMEFD
EHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMT
EARELLKCERCSVFLVDLDCCEESHLEKIIEKPHQLQQQRTPRAIMSGDSFEEKQNMRNR
FTVLFELGGENHAANVSRPSINDLSHSTLAQIAQFVATTGQTVNICDVQDWVREHNQIRA
ESEIDSTQAILCMPIVNAQKTVIGVAQLINKASGLPFTESDASIFEAFAIFCGLGIHNTQ
MYENACKLMAKQKVALECLSYHATASQDQTEKLAQDVIAEAEAYNLYSFTFTDFDLVDDD
TCRAVLRMFMQCNLVSQFHIPYDVLCRWVLSVRKNYRPVKYHNWRHALNVAQTMFAMLKT
GKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYTTSTMEHHHFDQCVM
ILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQGEEK
KDLLCGMMMTACDVSAIAKPWEVQHRVAKLVADEFFDQGDLEKLQLNTQPVAMMDRERKD
ELPKMQVGFIDVICLPLYRVLCDTFPWITPLYEGTLENRRNWQDLAEKVEMGLTWIDHDT
IDKPVEEFAGCADEEIKDIEFTVTTLNCNQHGGSAGGGEDTHTPEHQRSSSRLSIKKTGA
LGKVVRSKLSKTLYNSMDGSKPKTSLKLLESHVSEDMDDKSPTSPSQPHSGSVGRMSASS
STSSAGTVDKSKKRSKLCALL
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggagcacaataagtcgccgcgcaagttatccaattcatcggtgcatgcactgcccgag
agtcgacgccatttgatggaattggatgagggcgaactcttcatggagctgatacgtgac
gtggccaacgagctggacattgatgtgctgtgccataagatattggtgaacgtgggcctg
ctaacccatgcggatcgtggatctctctttctggccaagggcacgccaaacaacaggtac
ctggtggccaagctctttgacgtcacacaaacgacagcactcaaggatgcagtgacgcgg
gcgcgagccgaggagatcatcataccgtttggcatcggcatcgctggcatggtggcccag
acaaagcagatgattaacatcaaggaggcctacaaggatgctcgcttcaattgcgaaatc
gatttgaagaccggctacacaaccaacgccatactctgcatgcccatttgcaactatgag
ggcgacatcataggcgtggcacaaatcatcaataaaaccaatggctgcatggagttcgac
gaacacgatgtggaaatctttcgcagatatttgacattctgcggcattggcatacagaat
gcccagttgttcgagatgtccgttcaggagtaccggcgcaatcaaatcctcttgaatctg
gcacgcagcatcttcgaggagcagaacaatctcgagtgccttgtcaccaaaatcatgacg
gaggccagggagctgctcaaatgcgagcgctgctccgtctttctggtggatctcgattgc
tgcgaggagagccatttggagaagataatcgagaagcctcatcagctccagcagcagcgc
accccgcgtgccattatgagtggcgacagctttgaggaaaagcaaaatatgcgcaatcgc
ttcaccgtgctgttcgagctgggcggggaaaatcatgcggcgaatgtctcccggccctcc
atcaacgatctgagccactcgacgctggcgcagattgcccaattcgtggccaccaccggg
cagacggtgaacatctgcgacgttcaggattgggtgagggagcacaatcagatacgcgcc
gagagcgagatcgacagcacacaagccatactctgcatgcccattgtgaatgcccagaag
acggtcattggcgtcgcccaattgataaacaaggcaagcggtttgccctttaccgaatcg
gatgcatccatattcgaggcattcgccatattctgcggcctgggcatacacaacacgcag
atgtacgagaacgcctgcaagctgatggccaagcagaaggtggcattggagtgcctcagc
tatcatgcgacggccagccaggatcagacagagaaactcgcccaggacgtcattgccgag
gccgaagcctacaatttgtacagcttcacctttacggactttgacctggtcgatgacgac
acctgccgtgcggtgctgcgcatgtttatgcaatgcaatctggtctcacagttccacata
ccttacgatgtgctctgccgctgggtgctgagcgttcgcaagaactatcgcccagtgaag
taccacaattggcgacacgctctaaatgttgctcagacaatgttcgccatgctgaagacg
ggcaaaatggagcgttttatgaccgacctagagatactgggcctgctggtggcctgcttg
tgccacgatctggatcatcgcggcaccaacaatgcattccaaaccaaaactgagtcccca
ctggctatactctacaccaccagcaccatggagcatcatcatttcgatcaatgtgttatg
atactcaattccgagggcaacaacatattccaggctctgtcgcccgaagactatcgctcc
gtcatgaagactgtcgaaagcgcaatactctccaccgatttggcaatgtattttaagaag
cgcaacgcgtttctcgagctggtcgaaaatggcgaattcgattggcagggcgaggagaag
aaagatttgctgtgcggtatgatgatgacggcctgcgacgtgagcgccatagcaaagccg
tgggaagtgcagcatcgcgtcgccaagctagtggcagatgagttcttcgatcaaggcgat
ctggagaagctgcagctgaatactcagcccgtggccatgatggacagggagcgcaaggat
gagctgcccaaaatgcaggtgggcttcatagatgtcatttgtctgccgctctaccgagtg
ctgtgcgacacattcccctggataacgccgctgtacgaaggcacgctggagaacagacgc
aactggcaggacttggcggagaaagtggagatggggctcacctggatcgatcacgacacg
atcgacaaaccggttgaagagtttgccggctgtgccgatgaggagatcaaggacattgag
ttcacagtgacaacgctcaactgcaatcagcatggtggcagcgccggcggtggggaggac
acccacacaccggagcatcagcgcagcagctcacggctgagcattaagaagacaggcgcc
ttgggcaaggtggtgcggtcgaagctatcgaagacgctctacaacagcatggacggctcg
aagccaaagacatcgctcaaactgctcgagtcacatgtcagcgaggacatggacgacaag
agtccgaccagcccatcccagccacattccggtagcgttggccgcatgtccgcctcctcg
tccacatcgtccgctggcaccgtcgacaagagcaagaaacgctccaagctgtgcgcatta
ttatga

DBGET integrated database retrieval system