KEGG   Drosophila mojavensis: Dmoj_GI11077Help
Entry
Dmoj_GI11077      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dmo  Drosophila mojavensis
Pathway
dmo04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI11077
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmoj_GI11077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 6585898
NCBI-ProteinID: XP_002011522
FlyBase: FBgn0133839
UniProt: B4L7T7
Position
Unknown
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacatcgctgccaatggacatgtgctccaatttcgatgccgatgaaatt
cgtcgtttgggaaaacgttttcgaaaactcgatctcgataattcaggtgcactgagtatc
gatgaattcatgtcactgccggagctacagcagaatccgcttgtgcagcgtgttatcgat
attttcgatgccgacggcaatggtgaggtggacttcaaggagttcatccaaggcgtctca
cagttcagtgttcgcggcgataaactatcgaagttgcgtttcgcctttcgcatctacgat
atggacaacgatggctacatatcgaacggcgagctcttccaggtgctgaaaatgatggtc
ggcaacaatttgaaggatacgcaactgcaacagattgtcgacaagaccatttgctttgcc
gataaggatgaggatggcaagatctccttcgatgagttctgctctgtggtgggcaatacg
gatatacataagaaaatggttgttgatgtttaa

DBGET integrated database retrieval system