KEGG   Drosophila mojavensis: Dmoj_GI11100Help
Entry
Dmoj_GI11100      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Dmoj_GI11100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmo01001]
    Dmoj_GI11100
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dmo03036]
    Dmoj_GI11100
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmoj_GI11100
Protein kinases [BR:dmo01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   Dmoj_GI11100
Chromosome and associated proteins [BR:dmo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dmoj_GI11100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Seadorna_VP7 C1_2 Pkinase_C
Motif
Other DBs
NCBI-GeneID: 6585943
NCBI-ProteinID: XP_002011567
FlyBase: FBgn0133862
UniProt: B4L7Y2
Position
Unknown
AA seq 1365 aa AA seqDB search
MDVERRRRAKALEREMRDPTSSCNVDCLLDTVSALVSDCSHESLKRFKNIDQYACKYKPL
AQQINQLRMNVDDFDFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFW
EERHIMAHANSEWIVQLHFAFQDSKYLYMVMDFMPGGDIVTLMGDYDIPEKWAIFYTMEV
VLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGPNGQVVSSNAVGTPDYIS
PEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPAE
VEISENAKSLIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRQSVPPVVPELTSD
DDTRNFEDIERDEKPEEMFPVPKSFDGNHLPFIGFTYTGDYQLLSSDTVDAESKESQSVN
SSTNANNNHGHNHRHRPSNSNELKRLEALLERERARCEALEQQDTRLRQQLDLITKREAD
LQRIASEYEMDLTLRQHNYKVAMQKVEVEIELRKKAEALIVETQRKLENEQKTRMRDLNI
NEKVLTLEKQLHDMELSFKNETEQTQKLKKQNAELGFTLKTHEEKVRDLVELNKTLQKEK
EELDQENADLQAQVAQEKTLRSQLKVVHKEAENKMQTLTNDLERSLQREQKAQEDNRALL
EKISELERTHASLDFELKAAQGRYQQEVRAHQETEKSRLVSREEANLQEVKALQSKLNEE
KSARIKADQNSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQEHIKR
NSLLSERSLHTSEVAHLRSREAQLQKELAAQREAKRRLEEDLTQLKATHHEALANNRELQ
AQLEAEQCFSRLYKTQANENREESAERLSKIEDLEEERVSLKHQVQVAVARADSEALARS
IAEETVADLEKEKTIKELELKDFIMKHRNEINAKEATIAALKETEADLHKKLKSKSSELD
EMLAQHKKQLEELQQQRIAKDEEIAKLGEKCKNEVLLKQVAVAKLTEVMNRRDSDWPKQK
VKARSTAELRKKEKEMRRLQQELSQEREKYNQMLLKYQDLQQQAVEDQQVKQKMSMEIDC
KATEIEHLQSKLNETASLSSADNDPEDTQDSVFEGVLSVPNKQNRRRGQNWKRQYVIVSS
RKIIFYNTENDKNKTTDPVLILDLSKVYHVRSVTQGDVIRADAKEIPRIFQLLYAGEGAS
HRPDEQLDATLHASSNEERPGTILHKGHEFVHITYHTPSFCDVCAKPLWSVFKPPAAYEC
KRCRNKIHKEHVDKQDPLAPCKLHLDPRSARDMLLLANTPEEQSLWVARLLKRIQKSGYK
ANSSNNNTTDGSKISPSQSTRSAYKPYAPNVQRSATLPANSSLKQ
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggaaaggcggcgtcgagcgaaggcgctggagcgcgagatgcgcgatccgacc
agcagctgcaacgtggactgcctgctggacacggtttcggctctggttagcgattgtagt
cacgaatcgctgaagcgtttcaagaatatcgatcaatatgcatgtaaatataagcccctg
gcacagcagatcaatcagctgcgcatgaatgtggatgatttcgatttcattaaactgatc
ggagctggtgcctttggcgaggtgcagctggtcaggcataagtcatccagtcaggtgtac
gccatgaaacggctatccaaatttgagatgatgaaacgtccggattccgccttcttctgg
gaggagcgtcacattatggcgcacgcgaactccgaatggattgtacaattgcatttcgca
ttccaggatagcaaatacctgtacatggttatggactttatgccgggcggtgatatagtc
acgctaatgggtgactatgatatacccgagaaatgggccatattttacacaatggaagtg
gtcctcgccttggacaccatacacaatatgggctttgtgcatcgcgacgttaagcccgac
aatatgctattggatagctatggccatttgaagctagccgattttggcacctgcatgcgc
atgggccccaacggtcaggtggtgtccagcaatgcggtgggcacacccgactacatcagt
cccgaggtgctgcagtctcagggcgtggacaacgagtatggccgagagtgcgattggtgg
tcggtgggcatattcctatatgagatgctattcggcgagacgcccttctatgcggactca
ctcgttggcacctatggcaaaatcatggatcacaagaactcgcttagctttcccgccgag
gtggagatcagtgagaatgcgaagtcattgatacgcgccttcctcacggatcggacacag
cgattgggtcgctatggcatcgaggacatcaaggcgcatccgttctttcgcaacgatacg
tggtcgtttgataatatacgacagagtgtgccgcctgtggtgccggagctgacgtccgac
gatgatacgcgcaatttcgaggatattgaacgagatgagaagccagaggagatgtttccg
gtgcccaagagtttcgatggcaatcatctgcccttcattggcttcacctatacgggcgac
tatcagctgctgtcgagtgacacagtcgatgccgaatcgaaggagtcacagtcggtgaac
agcagcaccaatgcaaataacaatcatggacacaatcatcgccatcggccgtcgaattcg
aatgagctgaaacggctcgaggcgctgctcgaacgggaacgggctcgctgcgaggcactg
gagcagcaggacacgagattgaggcaacaactggatttgatcaccaagcgagaggccgac
ttgcagcgcattgcgagcgagtatgaaatggatttgacgctgaggcagcacaactacaag
gtggccatgcagaaggtcgaggtggagattgagctgcgcaagaaggcggaggcgttgatt
gtggagacacagcggaagctggagaacgagcaaaagacacgcatgcgtgatctgaatatc
aatgagaaggttctcacgctcgagaaacagctgcacgacatggagctgagctttaagaac
gaaacggagcaaacacagaagctgaagaagcagaatgccgagctgggcttcacgctgaaa
acgcacgaggagaaggtgcgcgacttggtcgagctgaataagacgctgcagaaggagaag
gaggagctcgatcaggagaatgccgacttgcaggcgcaggtggcgcaggagaaaacgctg
cgctcccagctgaaggttgtccacaaggaagctgagaacaagatgcagacgctgacaaat
gatttggagcgctcgctgcagcgggagcagaaggcgcaggaggataatcgtgcgctgctg
gagaagattagcgaactggagcgaacgcatgcgagtctcgatttcgagctcaaggccgca
cagggtcgctatcagcaggaggtgcgcgcacatcaggagacggagaagtcgcgtctcgtc
tcgcgcgaagaggccaatctgcaggaggtgaaggccttacagtccaagctcaatgaggag
aaatccgcacgcatcaaggccgatcagaattcgcaggagaaggagcgacagctgagcatg
ctgtccgttgactatcgccaaatccagttgcgtctacagaagctggagggcgagtgccgg
caggagtcggaaaaggtggccgcactccaatcccagctggatcaggagcatatcaaacgc
aactcgctgctctccgaaagaagtttgcacacttcggaggtggcgcatttgcggtcacga
gaggctcagctgcagaaggagctggcggcgcaacgcgaggctaagcgacgcttggaggag
gatctaacgcagctgaaggccacacatcacgaggcattggccaacaatcgggagctgcaa
gcccagctggaggcggagcaatgcttctcgcgcctgtacaagacgcaggcgaacgagaat
cgggaagagagcgccgagcgtttgtccaaaatcgaggatctcgaggaggaacgcgtctcg
ctgaagcaccaagtgcaagtggctgtcgctcgcgccgattcggaggctcttgctcgctcc
atcgccgaggaaacggtggccgatctcgagaaggagaaaaccatcaaggagctcgaactg
aaggacttcataatgaagcatcgcaacgagatcaatgccaaggaggcgactatagccgcg
ctcaaagaaaccgaagccgatctgcacaagaaactcaaatcgaagagcagcgaactggac
gaaatgcttgcgcagcacaagaaacagctcgaggagctgcagcaacagcgcatcgccaag
gacgaggagatcgccaagctgggcgagaagtgcaagaacgaagtgctgctcaaacaggtg
gccgtggccaagctaaccgaggtcatgaatcgtcgcgactccgactggccaaaacaaaag
gtcaaggctcgctccaccgccgaactgcgcaaaaaggaaaaggagatgcgtcgcttgcag
caggagctgtcgcaggagcgcgagaaatacaaccagatgctgcttaaatatcaggatctg
caacagcaggccgtcgaggatcagcaggtgaagcagaagatgagcatggagatcgattgc
aaggccaccgaaattgagcatctacagagtaagctcaacgagacggcctcgctgtcgtcg
gccgacaatgatccagaggatactcaggactccgtcttcgagggcgtcttgtctgtgcca
aataaacagaatcgccgccgcggccagaactggaagcgacaatatgtgatcgtctcgtcc
cgcaaaatcatcttctacaatacagaaaatgacaagaataaaacaacagatcccgtgctc
atactcgatctaagcaaagtctatcatgtgcgcagcgttacccaaggcgacgtcatacgc
gccgatgccaaagagattccgcgcatctttcagctgctgtacgccggcgagggcgcctcc
catcgtcccgatgagcagttggatgcgactctgcatgccagcagcaatgaggagcggcca
ggcaccattttgcataagggtcatgagtttgttcacattacgtaccacacgccatcgttc
tgtgacgtctgcgccaagccgctttggtccgtgtttaagccgccggcggcctacgaatgc
aagagatgccgcaataagatacacaaggaacatgtggacaaacaagatccactggcgcca
tgcaaactgcatttggatccgcgcagcgcacgcgacatgctgcttttggccaacacgccc
gaggagcaatctctgtgggtggcacgcctgctcaagcgtatacagaagagcggctacaag
gccaactcatccaataacaacaccacagacggcagcaaaatatcgcccagccaatcgaca
cgttccgcctacaagccgtatgcgccgaacgtgcaacgttctgccacgctgccggccaac
tcttcgttgaagcaatga

DBGET integrated database retrieval system