KEGG   Drosophila mojavensis: Dmoj_GI11219Help
Entry
Dmoj_GI11219      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00350  Tyrosine metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dmoj_GI11219
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dmoj_GI11219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON Suf
Motif
Other DBs
NCBI-GeneID: 6586161
NCBI-ProteinID: XP_002011784
FlyBase: FBgn0133980
UniProt: B4L7R1
Position
Unknown
AA seq 655 aa AA seqDB search
MSLQPSVQSAKCPMDVGAGQQHKEKQQQPQSLPPQPQSPQQKPAQRQRRSMQLLPVMLML
LLLTLLTRPLSVHSNRLSDTKLHEIFLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWF
YLGFSKRGGLADADICFFENQNGFFNVVTDTYTSPDGHWVRKDYQQDCEVFKMDEFTLAF
KRKFDTCDPLDLRLHEGTMYVVWARGESELALEDHQFALPNVTAPHEAGLKMLQLLRADK
ILIPETDLEQIEITLEQAPVPSQETTYWCHVQRLDDFVKNRMHIVQFEPIIKSPGIVHHM
EIFHCETDEHAEIPLYNGDCEQLPPAAKVCSKVMALWAMGASTFTYPPEAGLPIGGSGFN
PYVRLEVHFNNPELLEGLMDNSGFRIKLSKTLRQYDAGVMELGLEYTDKMAIPPGQTAFP
LSGYCVADCTRAALPKTGIIIFGSQLHTHLRGVRILTRHFRGEQELREINRDDYYSHHFQ
EMRTLHYKPRVLPGDALVTTCYYNTLGTANVTLGGFSISDEMCVNYIHYYPATKLEVCKS
SVSEETLEDYFIYMKRKEHQHGIHLNGARSANYRTIEWTQPHVDQLYTMYIQEPLSMQCN
RSDGQRFEGRNWEGVPPTPVQIKIPIHRKLCPNYNPLWLKPLEKGDCDLLGECIY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagccaagcgttcagtcggccaaatgcccaatggatgtcggcgcgggacaa
cagcacaaagagaagcagcaacagccgcagtcgctgccgccgcagccgcagtcgccgcag
caaaagccagcgcaacgacaacgtcgctcaatgcaactgctgccggtcatgttgatgttg
ctgctgctgacgctgctcacgcggccgctgagcgttcactcaaatcgtctctcggacaca
aagctacatgagatctttctggatgacaaggaaatcaagctgagctggatggttgactgg
tataagcaggaggtgctcttccatttgcagaatgcgttcaatgagcagcatcgttggttc
tatttgggcttttcgaaacgtggcggcttggccgatgcagatatttgtttctttgagaat
cagaatggcttcttcaatgtggtcaccgacacctacaccagccccgatggtcattgggtg
cgcaaggactatcagcaggactgcgaggtcttcaaaatggacgaattcacgctggccttc
aagcgcaagttcgatacctgcgatccgctcgatctgcgattgcatgagggcaccatgtac
gtggtatgggcacgcggcgaatcggagctcgctctggaggatcatcagttcgcgttgccc
aatgtgacggctccacacgaggcgggtctgaagatgttgcagctactgcgcgccgacaag
atcctcattcccgaaaccgacttggagcaaatcgaaatcacgctggagcaagcgccggtg
cccagtcaagagaccacttactggtgccatgtgcagcgtttggatgactttgtcaagaat
cgcatgcatatcgtgcagttcgagccaatcatcaagtcgcccggcattgtgcatcatatg
gagatcttccactgcgaaacggacgagcatgctgagattccactctacaacggcgactgc
gaacagctgcccccggcagccaaggtctgctccaaggtaatggcactgtgggccatgggc
gccagcacctttacgtatccaccagaagccggcctgccaatcggtggctccggcttcaat
ccctacgtgcggctcgaggtgcacttcaataatccagagctactggagggtctgatggac
aactctggatttcgcattaaattatcgaagacgctgcgacaatacgatgctggcgtcatg
gaattgggtctcgagtatacggacaaaatggcgataccgcctggccagacggccttccca
ctgagtggctactgtgtggcggactgtacacgggccgcattgccaaagacgggcatcatt
atatttggatcgcagctgcatacgcatttgcgcggcgttcgcatcctgaccagacacttc
cggggcgaacaggagctgcgggagataaatcgcgatgattactattcgcatcacttccag
gagatgcgcacgctgcactacaagccccgcgtcctgccgggcgatgcattggtcaccacc
tgctattataatacgcttggcactgcgaatgtcactctcggcggcttctccattagcgat
gagatgtgcgtcaactatatacactactatccggccaccaagctggaggtgtgcaagagc
tctgtttcggaggagacactcgaggattattttatctatatgaagcgaaaggagcatcag
catggcatacacctgaacggagcacgttcggcgaattatcggactatcgaatggacccag
ccgcatgtggaccaattatatacgatgtacattcaggagccgctcagcatgcagtgcaac
cgatccgatggccagcgctttgaggggcgcaattgggagggcgtgccaccgacgccagtc
caaatcaaaatacccattcatcgcaagctctgccccaactacaatccgctctggctgaag
cccctggagaagggcgactgcgatttgctaggcgagtgcatctactag

DBGET integrated database retrieval system