KEGG   Drosophila mojavensis: Dmoj_GI11811Help
Entry
Dmoj_GI11811      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00040  Pentose and glucuronate interconversions
dmo00053  Ascorbate and aldarate metabolism
dmo00830  Retinol metabolism
dmo00860  Porphyrin and chlorophyll metabolism
dmo00980  Metabolism of xenobiotics by cytochrome P450
dmo00982  Drug metabolism - cytochrome P450
dmo00983  Drug metabolism - other enzymes
dmo01100  Metabolic pathways
Module
dmo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmoj_GI11811
   00053 Ascorbate and aldarate metabolism
    Dmoj_GI11811
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmoj_GI11811
   00860 Porphyrin and chlorophyll metabolism
    Dmoj_GI11811
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmoj_GI11811
   00982 Drug metabolism - cytochrome P450
    Dmoj_GI11811
   00983 Drug metabolism - other enzymes
    Dmoj_GI11811
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmoj_GI11811
Glycosyltransferases [BR:dmo01003]
 Others
  Hydrophobic molecule
   Dmoj_GI11811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 6582753
NCBI-ProteinID: XP_002008444
FlyBase: FBgn0134570
UniProt: B4KZ94
Position
Unknown
AA seq 636 aa AA seqDB search
MRLLQLLSLWLLCSHATGANILAVLPSVWRSHYLFGRRLLQQLVAGPQNHSVTLISPHAL
SATDAGTALYRIREIRIEDQDLKQNWLDMGMSFEAEQMHAQSVMERFTRMIYAGTTNVDL
LLSDAQVQKLITSGEKFDLLIVDLFLSDALLGFAYYYGVPTVAISPTGANSWLNNMFGNP
QSAALDPSNFLPYTERMNTKQRITNMLMSTFERLTYNFFHLISQQSVYSNHFELLVRELP
NYRDLSKNLSLALINSHPAMDYPRAYLPNMLEVGGLHLLEPQELQVPNHVLSFMEAASSG
VIYMSLGAEVQTAQLPSEKLAILLDVFAHLKEFHFLLKWETEEFIQPLPDNIMINSWWPQ
QAILAHEQVKLFISSCGQLSVWESIAGDTPILAIPILAEQEVLAKRLQQKGAALTVAYDA
LAYDALLHSIRQLTLNESYAQHLGQLKKRLSVVNSEASARALSHIELILSTGGADFLKSH
ANSLNFWRSEGLDVLVIIALGIFGILTVPFVVTCCILRRSYYSQAAQDQQQQPYRTMLKS
VGRVHSHGDPSSCRSARSTEPLRRTRSAQSLSARSSCSSFSSTTPTTPSSNSTTPLDLTP
PPPTGATPAMDLYVNQGVYSAQKASAHDEKMEHAFL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctacaactgttatcgctttggctgctctgtagccatgctaccggtgccaac
attctggcggtgctgcccagcgtctggagatcgcattatctctttggacgtcgcctgctg
cagcaactggtggccggtccacagaatcattcggtgacgctgataagcccgcatgcatta
tccgcgacagatgcgggaacagctctctacagaatacgcgagatacgcattgaggatcag
gatctcaagcagaattggctggacatgggcatgagcttcgaggcggaacagatgcacgcc
cagagcgttatggaacgcttcacacgcatgatctatgcgggaaccacaaatgtggacctg
ctactatcggatgcacaggtgcaaaagttaataactagcggagagaaatttgatttactt
attgtggatttgtttctaagtgacgcattacttggctttgcctattactatggtgtgccc
accgttgcaatcagtcccaccggtgccaactcatggctcaataacatgtttggcaatcct
caatccgccgctcttgatccgagtaactttttaccctacacggagcgcatgaacacaaag
caacgcattacgaatatgctaatgagcacctttgagcgtctgacctacaactttttccac
ctgatctcccagcaatctgtttactcaaatcactttgagctgctggtccgtgagctaccc
aactatcgagacttgagcaagaacttgagccttgccttgatcaactcgcatcctgctatg
gattatcctcgagcctatttgcccaatatgctggaagtgggcggactacatttgctggag
ccacaagagctgcaagtgccaaatcatgtgctttcgtttatggaggctgcgtcgagtggg
gtcatctacatgagtcttggcgccgaagtccaaacggctcagttgcccagcgaaaagctg
gccatattgctggatgtctttgcgcatctcaaggaatttcattttctgctcaaatgggaa
acggaggagttcatacaaccgctgcccgataacataatgatcaacagctggtggccccag
caggccattctggctcacgagcaggtcaagctgttcattagcagctgcggccagctgagc
gtttgggagtccatagcgggtgatacgccaatacttgccatacccatactggccgagcag
gaggtgctggccaagcggctgcagcagaagggtgccgcgctaacagtcgcctatgatgca
ctggcctatgatgcactgcttcacagcatacggcagctgacgctgaatgaaagttatgca
cagcatttgggtcagctgaagaagcgtctgagtgttgtcaattcggaggcttcggcgaga
gcgctgagccacattgaactgatattgagcacaggtggtgctgatttcctaaagtcccat
gccaattcgctcaacttttggcgctccgagggcttggacgtgctggtgataatagcgctg
ggcatttttggaattttgactgtgccatttgtggtcacgtgctgcattctgcgtcgatcg
tactacagtcaagctgcacaggatcagcagcagcaaccgtatcgcaccatgctcaagagc
gtgggtcgcgtgcacagccatggggatccgagcagctgtaggagcgctcgctcaacggag
ccgttgaggagaacacgttcggcacaatcgctgtccgctcgctcaagctgctccagcttc
agttcgacaacaccgactacgccgtctagcaattcaacaaccccgctggatctgacaccg
ccgccaccgactggtgcaacgcccgctatggatctgtatgtcaatcagggtgtttatagc
gcacagaaagcatcagcgcacgacgagaagatggagcacgcgttcttatag

DBGET integrated database retrieval system