KEGG   Drosophila mojavensis: Dmoj_GI11853Help
Entry
Dmoj_GI11853      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI11853
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dmoj_GI11853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 Phage_TAC_6
Motif
Other DBs
NCBI-GeneID: 6582676
NCBI-ProteinID: XP_002008369
FlyBase: FBgn0134611
UniProt: B4KYV3
Position
Unknown
AA seq 316 aa AA seqDB search
MARLIESNFVPIAMGVAAIVAGALIVHYFINKKSTKPRREPNRTARLRTLVDPNDKYQLP
LIEKEVLSADTRRFRFGLPSKQHILGLPVGQHIHLIATIDNELVIRPYTPISSDDDVGYV
DLIVKVYFKDTHPKFPAGGKMTQYLERMELGDKIAFRGPSGRLQYLGNGTFSIKKLRKDP
PKQVTAKCVNMIAGGSGITPMLQLVREVLKHSDKDKTQLALLFANQSEKDILLRDELDTL
AKQHPDQFKVWYTVDKASEGWTYSVGFVNDEMIAAHLLPANDDTIVLLCGPPPMINFACN
PALDKLGYHPDLRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtctaattgagagcaattttgttccgattgctatgggcgttgcagccatcgtt
gccggggcattgatagtccactattttatcaataagaagtcgacgaagccccgtcgcgaa
cccaaccgaactgcacgattacgcactctggtcgatcccaatgataagtaccagctgcca
ctgatagagaaggaggtgctcagcgctgatacgagacgttttcgcttcggtctgccctcc
aagcagcatatactgggtctgcctgtgggccagcatatccatctgatagcgacaattgac
aatgagctggtcatacggccgtatacacccatctcctccgatgacgatgtcggctacgtg
gacctgattgtgaaggtgtacttcaaggatacgcatcctaaattcccagcgggtggcaaa
atgacacagtacttggagcgaatggaattgggcgataagatcgcgttccgtggtccctcg
ggtcgcttgcaatatctgggcaacggcaccttctccattaagaaactccgcaaagatcca
cccaagcaagtgacggccaagtgcgtcaacatgattgccggcggcagtggcattacgccc
atgttgcagctcgtgcgcgaagtgctcaagcacagcgacaaggataagacacagctggcg
ctgctctttgccaatcagagtgaaaaggatatcttactgcgtgacgaactagataccttg
gccaagcagcatcccgatcagtttaaggtctggtacaccgtggacaaagcaagcgaaggc
tggacttatagtgttggcttcgtcaatgatgagatgatcgccgctcatctgctgcccgcc
aatgacgacacgatcgtgctgctctgcggcccgccgcccatgattaactttgcctgcaat
ccagcactagacaagctcggctaccatccggacctacgatttgcgtattag

DBGET integrated database retrieval system