KEGG   Drosophila mojavensis: Dmoj_GI12703Help
Entry
Dmoj_GI12703      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00052  Galactose metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI12703
   00052 Galactose metabolism
    Dmoj_GI12703
Enzymes [BR:dmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dmoj_GI12703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 6581279
NCBI-ProteinID: XP_002007021
FlyBase: FBgn0135460
UniProt: B4KWQ0
Position
Unknown
AA seq 363 aa AA seqDB search
MVHVTEDVFATAAVDPFTKQTGPIRRITLSNDEQMSVQILTLGATISSIKVPDAQGQVED
VTLGFDDLAGYQGENNPYMGATIGRVCNRIANGRFQLDGQAIEVSRNRGTFQLHGGFIGF
DKAHWKVLEVLPNGVSMTHTNPDGHEGYPGEVQATVTFTLTEDNCLHVRMDALTSKATPV
NLTNHSYFNLAGHKAGRKGLYEHNISINAYGITETDNESIPTGKILPVDGGKFDLRLISN
LGERLEQLQPALGYDDNFCVQFEPPQSFANVARVSHPPSGRWLEVASNQPGVQFYTSNFL
PDTAKGERALAGKAGAAYVKHGAFCLETQKFPDSVNHANFPSTILRPEEKYHHEVIYKFG
RQR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacgtcacggaagatgttttcgctactgcagcagtggatccctttactaagcag
acgggtccgattcggcgcattacgctctccaatgatgagcaaatgtcagtgcagatttta
acgctgggcgcaacgatcagtagcattaaagtgcccgatgctcaaggtcaagtggaggac
gtgactctcggctttgatgacctggcgggctatcaaggagagaataatccatatatgggt
gcgacaattggacgcgtttgcaatcgcatagccaacggcaggttccaactggatggccaa
gcaattgaggtgtcccgcaatagaggaacatttcagctgcatggcggatttataggattc
gataaggcacattggaaggtgttggaggtgctacccaatggagtcagcatgacccacacc
aatcccgatggccacgaaggctatccaggcgaagtccaggctacagttaccttcacttta
accgaagacaattgcctgcatgtgcgaatggatgcgctgaccagcaaagcgacgcctgtg
aatctcacaaatcattcctactttaatctagccggccataaggcaggtcggaagggactc
tacgaacataacatatctatcaatgcctatggcataacggaaaccgacaacgaatctata
ccaacaggcaaaatattgcctgtggatggtgggaaattcgatttacgcttaattagcaat
ctgggggaacgccttgagcagctgcagccggccctgggttatgatgacaacttttgcgtg
cagtttgagccgccgcagagctttgccaatgtagctagagtatcgcatcctccaagcggt
cgctggctagaagttgccagcaatcaaccgggcgtgcagttctatacatccaacttttta
ccagatacagcaaagggagaacgtgcgctggctgggaaagcaggcgcagcgtatgtgaag
catggagctttttgtctcgaaacgcaaaagtttccggattctgtgaatcatgcaaacttt
ccctctaccatattgcgaccggaggagaaataccatcatgaagtcatctacaagttcggc
aggcaacgttaa

DBGET integrated database retrieval system