KEGG   Drosophila mojavensis: Dmoj_GI12986Help
Entry
Dmoj_GI12986      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00900  Terpenoid backbone biosynthesis
dmo01100  Metabolic pathways
Module
dmo_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dmoj_GI12986
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dmo01006]
    Dmoj_GI12986
Enzymes [BR:dmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Dmoj_GI12986
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Dmoj_GI12986
    2.5.1.29  geranylgeranyl diphosphate synthase
     Dmoj_GI12986
Prenyltransferases [BR:dmo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Dmoj_GI12986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 6581783
NCBI-ProteinID: XP_002007505
FlyBase: FBgn0135743
UniProt: B4KZW9
Position
Unknown
AA seq 337 aa AA seqDB search
MDELNGILQKTKDKSTQREQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPPEKLTQ
IGEIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYTLFLALEKVQQLGH
PEATKVYTEQLLELHRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSE
NKEDFTKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDK
QVLHILRQRTHDIEVKKYCISLLEKLGSFQYTRKVLESLDAEARAELARLGGNPFLDRLL
NKLLSWQNSESASITQSNQINHNNVTRSPNQNTLNCN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacgagctgaatggaatattgcaaaaaaccaaagataaatcaactcaaagggaacag
gacgagattctgctgcagccctttacgtacatacagcaaatacctggcaaacagtttcgc
tccgaattggccttggccttcaatcactggttgcttataccgcccgaaaagttgacgcaa
attggcgagattgtacaaatgctgcataattccagtttgctcattgatgatattgaagac
aattcgatacttcgcagaggtgtgcccgttgcgcattctatttatggcgtggcgagcacc
atcaatgcggccaattatactctgttcctggcgttggaaaaagttcagcaactgggccat
ccagaggcaaccaaggtatacacggaacagctattggaactgcatcgcggccaaggcatg
gagatttactggcgcgatagctttacatgtccctccgaatctgattacaaactgatgact
gtacgtaagactgggggcctgttcatgctggccatacgcctgatgcagctgttcagtgag
aacaaggaggatttcacaaagttaactgccattttgggcctatattttcaaatacgtgac
gattactgtaatttgagtttgaaagagtacacggaaaataagagctttgctgaggacttg
actgagggcaaatttggatttccagtcatacatgcagtgcgtacgcagaagcaagacaaa
caggttttgcacattttgcgacagcgcacgcacgacattgaggtcaagaagtactgcatt
agcctgctagaaaagcttggcagctttcagtacacacgcaaggtgctcgaaagtcttgat
gcggaggcgcgtgccgagttggctcgtctgggtggtaatcccttcttggatcgactgctc
aataagctgttgtcctggcagaacagcgagagcgccagtatcacgcagtcgaaccaaatc
aatcacaacaatgtcacacgcagccccaatcagaacacgctcaactgcaattaa

DBGET integrated database retrieval system