KEGG   Drosophila mojavensis: Dmoj_GI13402
Entry
Dmoj_GI13402      CDS       T01062                                 
Name
(GenBank) uncharacterized protein
  KO
K03953  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
dmo  Drosophila mojavensis
Pathway
dmo00190  Oxidative phosphorylation
dmo01100  Metabolic pathways
Module
dmo_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmoj_GI13402
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NmrA RmlD_sub_bind NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: EDW18752
FlyBase: FBgn0136159
UniProt: B4KY50
AA seq 417 aa
MAAIVLTRNMQLAKHHGSGIVGVVCLRSYSAAAAPPDPDAPRPLKTTNLAAMKRGTGGRS
SFNGIVATVFGATGFVGRYVCNKLGKSGSQMILPYRGDDSDAIRLKVCGDLGQVLFHFYH
LDDPRSIREAVKHSNVVINLVGRDYETKNFRFKDVNVNGAARLASICRESGVERFIHLSA
LNAEANPKPHYISGGSQWLKTKYEGELMVRDAFPNATIIRPADIYGSEDRFLRYYAHIWR
RQFRSMPLWHKGERTVKQPVYVSDVAQAIVNAAKDPDTAGRIYQAVGPKRYQLSELVDWF
HRLMRKDQKGWGYQRYDMRWDPTFKLKVKLTNLICPGAPIGGLHLDRVEREAVTDKVLPG
VPTLEDLGVQLTNMEDQVPWELRPYRAALYYDAELGEFETPSPPKTIAPRDEMRLFA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggctgccatagtgctaactaggaacatgcagctggccaagcatcatggcagcggtatc
gttggtgtggtatgcctgcgaagctacagcgccgccgctgctccgcccgatccagatgct
ccacgcccactgaagacaacaaatctggctgccatgaagcgcggcacaggcggacgcagc
agcttcaacgggattgtggctacggtgttcggtgccaccggatttgtgggtcgctatgtg
tgcaacaaactgggcaagtcaggcagtcaaatgattttgccatatcgcggtgatgattcc
gatgcgattcgtctaaaggtttgcggtgacttgggccaagtgctgttccatttttaccat
ctcgatgatccgcgctccatacgcgaggcagtgaagcactcgaatgtggtcatcaatttg
gttggtcgtgactacgaaacgaagaactttagattcaaggatgtcaatgtcaatggagct
gcgcgtctggctagcatttgtcgggaatccggcgtggagcgttttatacatctgtctgcg
ttgaatgctgaggccaatcctaagcctcattatatctccggcggcagccaatggctgaag
accaagtacgaaggcgaattgatggtgcgcgatgccttcccgaatgccaccatcatccgt
ccggccgacatttatggttccgaggatcggttcttacgctactatgcacacatctggcgt
cgtcagttccgctcgatgccactgtggcacaagggcgagcgcacggtgaagcagcctgtg
tatgtttcggacgtggcgcaggcgattgtcaatgctgccaaggatccagataccgccggc
cgtatctaccaggctgtgggacccaagcgatatcagctgagcgagttggttgactggttc
catcgcctgatgcgcaaggatcaaaagggttggggctaccagcgctatgatatgcgctgg
gaccccactttcaagctaaaggtgaaactcaccaacttgatttgccctggtgcccccatt
ggtggactgcatctggatcgcgttgagcgtgaggccgtcactgataaggtgctgcccggc
gtgccaacgttagaagatttgggcgtgcagctaacgaatatggaggatcaggtgccctgg
gagctgcgcccatatcgcgctgctctgtactacgatgcggagttgggcgaattcgagact
ccgtcgccgccaaaaacaattgcgccacgcgatgagatgcgtctgtttgcttaa

DBGET integrated database retrieval system