KEGG   Drosophila mojavensis: Dmoj_GI13829Help
Entry
Dmoj_GI13829      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K10180  T-box protein 6
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dmo03000]
    Dmoj_GI13829
   03019 Messenger RNA biogenesis [BR:dmo03019]
    Dmoj_GI13829
Transcription factors [BR:dmo03000]
 Eukaryotic type
  Other transcription factors
   T-box
    Dmoj_GI13829
Messenger RNA biogenesis [BR:dmo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     Dmoj_GI13829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 6583371
NCBI-ProteinID: XP_002009041
FlyBase: FBgn0136583
UniProt: B4KVW6
Position
Unknown
AA seq 432 aa AA seqDB search
MLALPNIADLRMQQQIAHELYRQQIMQRLPDPLCGLLPNFGSHFVAPAVAQPSLPGVEAK
LENNELWQQFHHIGTEMIITKSGRRMFPSMRVSLSGLEEEANYCVLLEMVPIGDCRYKFS
GSQWVPAGGAEPQSPQRMFLHPDSPATGKHWQSQALLFSKVKLTNNTLDNNGHIVLASMH
KYQPRLHVIRTADLTQIPWAPQQAFVFPETEFIAVTAYQNDRITKLKIDNNPFAKGFRET
GQSRCKRKLNDSSSAPAHAEGTGAVNNMELTASPSAKRLRLPEELSLLPPQQQQPASGLL
MPRHYLLDTLEANFYLSAPPPPLPCIDYARHIASYPSWAYSPPSPDSSRASSSSSGCDSA
AEPETDTFVDVVGTTTSPPEPDLESESISRITGMANVAVAAAAAAAVAVAAVPKPKRSSF
SILDILGVSVSS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttggcactgccgaacattgcggatctgcgcatgcagcagcagattgcgcacgagctt
tatcgccagcaaattatgcaacgtctgccagatccactgtgcggccttttgcccaatttc
ggttcgcatttcgtggcgcccgcagtggcgcagccctcgctgcctggcgtggaagcgaag
ctcgagaacaacgaactgtggcagcagttccatcacattggcaccgaaatgatcatcaca
aagagtggcagacgtatgtttccatcgatgcgtgtctcgctcagcgggctggaggaggag
gccaactattgcgtgttgctggagatggtgcccattggcgactgtcgctacaagttctcc
ggatcccaatgggtgccggctggcggtgccgagccccagagtccacagcgcatgttccta
cacccggacagtcccgcaacgggcaaacattggcaatcacaggctttgctgttcagcaaa
gtcaagctaaccaacaatacgctggacaacaatggacatattgtcttggccagcatgcac
aagtatcagccacgactgcatgtgattcgcacagccgatctgacccagataccctgggcc
ccgcagcaggccttcgttttccccgaaactgagtttatagctgtcacagcgtatcagaac
gatcgcatcacaaagctcaaaatcgacaacaatcccttcgccaagggcttccgcgagacg
ggccagtcacgctgcaagcgtaagcttaacgactcctcctctgcgcctgcacatgcagag
ggtacgggagccgtcaacaacatggagctcacagcctcgccgtcggccaaacggctgcgt
cttcccgaagagctctccctgctgcctccacagcaacagcagccagcgagcgggctgctg
atgccgcgccattatctgctggatactctggaggccaatttctatctgtcagcgccaccg
ccgcccctgccgtgcattgattatgccagacacatcgccagctatccaagttgggcctat
tcgccgccatcgcccgattcgtcgcgtgcctcctcctcctcgtctggctgcgattccgcc
gccgagccagagaccgatacctttgtagatgtagtgggcaccacgacaagcccgccagag
cccgacctggaatccgaatcgattagccgaatcactggtatggccaacgtagccgttgcc
gctgctgctgctgccgccgttgctgtcgctgcggtgccgaagcccaaacggagcagcttc
agcatcttggacatattaggagtgagcgtctcgtcttag

DBGET integrated database retrieval system