KEGG   Drosophila mojavensis: Dmoj_GI13879Help
Entry
Dmoj_GI13879      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dmo  Drosophila mojavensis
Brite
Chromosome and associated proteins [BR:dmo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dmoj_GI13879
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI13879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6576210
NCBI-ProteinID: XP_002002206
FlyBase: FBgn0136633
UniProt: B4K7B3
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctaagacaagtggaaaggcagccaaaaaggctggcaaggcccagaagaatatt
accaagaatgataagaagaagaagcgcaagaggaaggaaagttatgctatctatatttac
aaagtgctaaagcaggtccatcctgacactggaatctcgtcgaaagcaatgagcatcatg
aacagcttcgtgaacgacatttttgagcgtattgctgctgaggcgtctcgtttggcacac
tacaacaaacgttcaacgattaccagtcgggaaatccaaactgcagtccgtcttctgttg
cccggagagttggccaagcacgctgtcagtgaaggaaccaaagcagtaaccaagtacact
agctccaagtaa

DBGET integrated database retrieval system