KEGG   Drosophila mojavensis: Dmoj_GI14172Help
Entry
Dmoj_GI14172      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dmoj_GI14172
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dmo01007]
    Dmoj_GI14172
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dmo03016]
    Dmoj_GI14172
   03029 Mitochondrial biogenesis [BR:dmo03029]
    Dmoj_GI14172
Enzymes [BR:dmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Dmoj_GI14172
Amino acid related enzymes [BR:dmo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Dmoj_GI14172
Transfer RNA biogenesis [BR:dmo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dmoj_GI14172
 Prokaryotic type
   Other AARSs
    Dmoj_GI14172
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dmoj_GI14172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1
Motif
Other DBs
NCBI-GeneID: 6586698
NCBI-ProteinID: XP_002012308
FlyBase: FBgn0136925
UniProt: B4L9V4
Position
Unknown
AA seq 384 aa AA seqDB search
MLFDTDDNFKRRAYNRVVTLQNGTTESIKAWKLICDVSRKEFQKIYDRLDVTINERGESF
YQSRMVSVVEFLRNKGFLELDEGREIMWPDDSKSGIPLTIVKSDGGYTYDTSDMAAIRHR
IEEDHATWIIYVVDSGQSTHFNAIFKAAERCGILNPNVHRVDHVQFGVVLGDDGKKFKTR
SGDTVKLSDLLDEGMKYSLKQLQQRGRDKILTPKELLEAQEAVAYGCIKYTDLCHNRISD
YIFSFDKMLDDRGNTAVYLLYTYSRICSIARSSGKDFSNVEDILDKFNIELIHEKEWKLA
KTLLKLHDVLIKCANSLFLHFLCEFCYEVSVVFTEFYDSCYCIEKNEAGQIINVNHSRIL
ICEATAAVLRKCFHILGLKPVTKM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgatactgatgacaattttaaaaggcgggcttacaatcgagttgttacactc
caaaatggaacaacagaatcaattaaagcttggaaactcatatgtgatgtttcgcgtaaa
gaatttcagaaaatttatgatcgcttagacgtaacaattaatgaacgtggcgaatcattt
tatcagtcacgtatggtgtcagtagttgaatttctgcgaaacaagggttttctggaattg
gacgaggggcgggaaatcatgtggcctgatgacagtaagagtggcattccgttgaccatt
gtgaaatcagatggtggatatacatacgatacctctgatatggcggccattagacatcga
attgaagaagaccatgccacttggataatttacgttgtggattctggacaaagcacccac
tttaacgcaattttcaaggctgcggagcgttgtggtattttaaatccaaatgttcatcgt
gttgatcatgtacaatttggagtggtgctaggagatgatggcaaaaaatttaagacacga
tctggtgatactgttaaactatcagacctgctggacgaggggatgaagtattctttaaag
cagttgcagcagcgcggtcgtgataagatattgacacctaaagaactgctcgaagctcaa
gaagcggtggcatatggctgcataaagtatacagatttgtgtcataaccgtataagcgat
tatatattttcatttgataaaatgctcgatgatcgtggaaatacggcggtatacttgtta
tacacgtatagtcgtatttgttctattgcccgtagctccggaaaagattttagcaatgtg
gaagatattttggacaaatttaacatagaactgattcacgaaaaagaatggaaacttgca
aaaacactcctaaaattgcatgatgtattaattaaatgtgccaatagtttatttctacac
tttctttgtgagttttgttatgaagtttccgttgtatttactgaattctatgatagctgt
tattgcattgaaaaaaacgaagctggtcaaattattaatgttaaccacagtagaatttta
atatgtgaagcaactgcggccgtgttacggaaatgtttccatatattgggcttaaaacct
gtaacaaaaatgtag

DBGET integrated database retrieval system