KEGG   Drosophila mojavensis: Dmoj_GI16257Help
Entry
Dmoj_GI16257      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI16257
Membrane trafficking [BR:dmo04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    Dmoj_GI16257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 6575542
NCBI-ProteinID: XP_002001553
FlyBase: FBgn0139006
UniProt: B4KFN0
Position
Unknown
AA seq 2053 aa AA seqDB search
MSTAQRSFVQKMSKQPAADVRKNISVHMQSKTTSCTSMCSSTLSLTEPLDYEEFLIQHMN
IINRDPLKHILDFPQGDVSIKTIPRKIRTIDHIIPNENISELPKHVQESIRCYTRPWKVV
EYAHRHYSSSSCARERIDRDTTSPSAYQQEFEIDKDFSSFDESFTDKSESCTPSSRQSIA
SLASVSSCTDTLTPRSSWASFDLRRSVNDPLIPNLLDNVPPDQIDQLNEMRRQEDRQGVF
FSLYPEIESEEAIERRLQAELPVEHIGHRILVKCLQLRLELEVEPIFASMAIYDAKERQK
VSENFYFDMNSDSLKLMLSTHVRCADVSTQSRSAIFEISYPSNDLFLVIRLEKVLQGDIN
NSVEPYLKEDKEKYREKVKSNAMDYCERLGKYRMPFAWTAIYLTNVFNGDNFENKDSCAG
DRDSSNSGGNAVLGSAASSNSLDRKSSTSSFDQLRRKANDMSGTLTRRGSLERKEKRRSW
SPDDFANVVENFRPITLTVPNFFKQEPDKMKDDDLYKILPELKRPSTVMKKYKCIPGSIK
LEISPCVEDVTNALTPELAKIEPHSGDNTRPTKEILEFPLLPIYNPYYSYRNLLFVSPKE
LNFSSRAGSARNIAIRIQLMSGETQADAVNAIFGKSSCPEYATDVFTCVNYHNKCPSFYD
EIKIALPASIKEHHHLLFTIYHVSCQKKPHELQLPVETPIGYTWLPLLEDGKLRVGEFNL
PVMVEAPPKNYSFIPPNVHLPGIKWLDNHRAVFSINIAAVTSVHTLDAHLDRFFLICEYL
DTRNIPSHIGEGNMEAELKKCLLDIEHANRESLVKHLPLVLDKLIELLVTTHKVGGQTLC
LSSTVFEVLCLVSAHLSILSDVDQYGRQSLFSTYVQFQCKIPHPLMTKRHTARHPANEFL
SKESYDIYDALSTDTTDLQSEAQLESDMTIRLLHEELALQYTLSSGKAADLAMTNSWFLF
ELIVKSMIEHLDNSGTLNAPRKHRFPQQFNDDIATLVDIVTNKVMEYHSTDPRLAQSLNA
SLSFLIFDLLSIMDRGFVFGLIQIYSKRIISTSASGPELMNYKIDFHRIVCSHEHFVALN
FPFGTSYTTFSAPCSPTPSTTSSTSQTSYGSIERSLHADLSSEFRQQHFLVGIVLSDLAT
IMEIPNPQLHGKAINCIRNLLTSHDSRYDAEVRSRVASLYIPLLSIVMDTFSQLHQYPSD
AQDHDRLQQMGQLEDYQGPHQTIAKATISPEVAYAISGSRVYSYMTEPSKSKVPLNAENT
RHLLACFLWVLKNLERTVLYRWLLGLSPHRVHQMLQVLNTCLKAFEYSGQKRLPSLKRTN
THSFRKSAPTDVKDKLEECIRGTNSARYDLINRRKDRNSTEKLRWRKDHMPYRSQYCESA
NKNETELEMSHFIEGSLSTEIALIILDSLEIIVHVATNLHHNLLGTVLKVLLHSLSRNQS
TLALQNLFASQRALIFKFPNLLFDEETDICADLCLLLLKHCASQLPGIRSQAAASLYLLM
RQNFEIGNNFARVKMQVTMSLSSLVGTSASFSEQSLRRALKTVLVYAESDTDLQETSFPE
QVQDLLFNLHMILSDTVKMKEYQEDPEMLLDLMNRIAKGYQNNPDLRLTWLENMAKKHRE
RANHTEAAMCYIHGAALVSEYLSMLESQTHLPIGAVSFQRISPNTFMESAVSDDVLSPGE
DGICLGNHFTETGLKALLEEASNSFQVAGMYEAMNEVYKILLPICEANREFHKLGKIHGK
LQEAFNRIAQLHGKRVFGTYFRVGFYGAKFGDLDQQEFIYKEPTLTKLPEIFSRLQNFYT
ERFGPDSVHIIKDSNNFDPNTLDPEKAYIQITYVEPFFETYEMRHRETYFERNFNIKRFI
FSTPFTKSGKAHGELHEQCKRKTILTTANHFPYVKTRIQVINRTQFQLEPIEVAIEDIQK
KTLELAAATNQEPADPKILQMVLQGCIGTTVNQGPMEMASVFLSNLSDGTTIPTKHQNKL
RLCFREFSKRCADALKKNRNLILSDQKDYQRELERNYERFVERLMPLITLSSAQTQGVVK
ANAFQNKSTPLKW
NT seq 6162 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgcccaaaggtcatttgtgcagaaaatgtcaaaacaaccggcggctgatgtc
cgcaaaaacataagtgtgcatatgcaatctaagactaccagctgcacatcgatgtgctca
tcgacactgtcccttaccgaaccgcttgattatgaggaatttcttattcaacacatgaac
attattaaccgagatccgttaaaacatattttggattttccacaaggagatgtatcaatc
aaaaccataccaagaaagattcgcacaatagatcacattatacctaatgagaatatatct
gaattaccaaaacatgtacaggagagcattcgctgttacacacgtccttggaaagttgta
gaatatgcacaccgccattactcaagttcgtcttgtgcacgtgaacgtattgatcgcgac
actactagcccttcggcgtaccagcaagagtttgagattgacaaggatttttcgtcattt
gatgaatcattcaccgacaaaagcgaaagttgcacgcctagttctagacagtctatagct
agtttagcttcagttagctcttgtaccgatacgctaactcctcgtagttcttgggctagt
tttgatttgcggcgctcagttaatgatcctcttattccaaatttattggataatgttccg
ccagatcagatagatcaattgaatgaaatgcgtcgtcaagaagatcgtcaaggagttttt
ttttctctctatccagaaattgaaagtgaagaagctattgagcgcagattacaagcagag
ctgccagtagagcatataggtcatcgcatactcgtaaagtgccttcagctcagattggaa
ctagaagtggaacctatattcgcatcaatggccatttatgatgccaaagagcgtcaaaaa
gtatctgaaaacttttactttgatatgaattcggacagtctaaaacttatgctgtcaacc
catgtgcgttgtgcagatgttagcacacaaagtcgttcggctatatttgaaatttcttat
ccaagtaatgatttatttcttgttataaggcttgaaaaagtactccaaggtgacataaat
aattctgtagaaccatatctgaaagaagacaaggaaaaatatagagagaaagttaaatct
aatgccatggattattgtgagcgccttggaaaatatagaatgccttttgcatggacggct
atatacttgactaatgtttttaacggcgataactttgagaacaaggattcttgcgctggc
gatagagattcgtctaacagcggaggtaatgccgttttaggttctgccgcaagctcaaac
agcttagatcgaaagtcttctactagcagttttgatcagcttcgcagaaaagctaatgat
atgagcggtactctcacaagacgtggttcattagagcgcaaagaaaaacgtcggtcatgg
tctccagatgatttcgccaatgttgttgaaaattttcgtcctattaccttaacagtgcct
aatttctttaaacaagagcctgataaaatgaaagatgacgacttatacaaaatcttaccg
gaacttaagcggcctagtacggttatgaaaaaatataaatgtattccgggctctataaaa
ttggaaatatccccatgtgttgaagatgttacaaatgcgttaacgccagaattggctaaa
atcgaaccgcacagtggagataacacccgtccaactaaagaaatattggagtttccgttg
cttccaatttataatccgtactatagctatcgtaatttgctatttgtgtctcccaaagag
ctaaatttttcatcacgtgcaggctccgcacgtaacattgccattcgcattcagctaatg
tcaggagagactcaagctgatgcagtcaatgccattttcggaaaatcgtcatgcccagaa
tacgcaacggatgtatttacttgcgttaattaccataacaagtgcccctcattctatgac
gagattaagattgcccttcctgcttctatcaaagagcaccatcatttattgtttactatc
taccatgtgtcatgccaaaaaaaaccacacgagttacaacttccggtggaaactcccata
gggtacacttggttaccacttcttgaagatggaaaactaagagttggcgaattcaaccta
cctgtcatggttgaagcacccccaaaaaattattcttttataccaccaaatgttcatctt
cctggtataaaatggctcgacaaccatcgcgcagtattttcaattaatattgccgctgtc
acttcagttcacacattggatgcgcatcttgatagattctttttaatatgtgaatactta
gacacccgaaatataccttcgcatataggtgaaggtaatatggaagctgaactaaaaaag
tgcttgctagatattgagcatgccaatcgagaatctcttgtaaagcatttgccccttgta
ttagataaacttattgaattactagttactacacataaagtaggcggacagactttgtgc
ttaagctcgacagtgtttgaagtgctttgtttggtttcagcacatttgtcaatactaagc
gatgtagaccagtatggacgtcagagtttgttttccacttatgtccagtttcagtgcaaa
ataccacacccgttaatgacaaaacggcacacagcacgacatcctgcaaatgaattctta
tcaaaagaatcatatgacatttatgatgctttaagcactgatactacagatttacaaagt
gaagcacagttagaatccgacatgactattcggttgcttcacgaagagcttgctctgcag
tatacattgtctagtggaaaagccgctgatttggccatgactaattcgtggtttcttttt
gagcttattgtgaaatctatgattgagcacttggacaattcgggtaccttaaatgctcca
cggaaacaccgattcccacagcaatttaatgacgacattgctacgctagtggatattgta
actaacaaagttatggaataccacagcacagacccaagattagctcagtcattaaacgct
agcttaagctttttaatttttgacctattgagcattatggatcgtggatttgtctttggc
cttattcaaatatactcgaagcggataatatcaacaagcgcttctggacctgagttaatg
aattacaaaattgactttcatcgaattgtgtgtagtcatgagcattttgtagcgttaaat
tttcccttcggcacttcctacactacattctcagcgccttgcagcccaactcccagcact
acatccagtactagtcagacttcatatgggtccattgagcgttccttgcacgctgatctt
agttctgaatttcgccaacaacattttctcgtcggcattgtattaagtgatttggctact
ataatggaaatccccaatccccaactgcatggaaaagcaatcaactgcattcgtaatctg
ttaacttcacatgattcacgatacgatgcagaagtacgctcgcgagtagcttcactttat
atacctctgctctcgattgttatggatactttttcgcaacttcatcagtatccgtcagat
gctcaagatcatgatcgcctccagcaaatgggacaacttgaagactatcaaggacctcat
cagactatagccaaagctactataagcccagaagtagcatatgctatttctggtagtcgt
gtatactcttacatgacagagccatcgaaaagcaaagttcccttaaacgcggagaatacc
cgtcatttgttggcatgtttcctttgggtacttaaaaatttggaacgcactgtgctctat
cgatggctacttggcttaagcccgcatcgcgttcaccaaatgttacaagtactaaacaca
tgcttaaaagctttcgagtactccggtcaaaagagattgccctcattaaaacgaactaat
actcatagttttcggaaatcagcgccaactgacgttaaagacaagctggaagaatgtatt
cgaggaacaaactcagcacgttatgatttgattaatcgtcgcaaagatcgcaattctact
gagaaacttcgttggcgcaaggatcacatgccatatcgttcacagtattgtgaatctgca
aacaaaaatgaaacagagcttgaaatgagtcactttattgaaggttcactttctactgaa
atcgcacttatcatactagattccttagaaattatagtgcacgtggctaccaatcttcat
cacaaccttctggggacagtactaaaagttctattgcatagtttatcccgcaatcaatcg
acattggcattgcaaaatttgtttgcttctcaaagagccttgatctttaaatttccgaat
ctactgtttgatgaagaaaccgatatatgcgcggacctatgcctattactcttaaaacat
tgcgcatcacaacttccaggaattcgttcacaggcagctgcatcattgtacttgctgatg
agacaaaactttgaaattggaaataatttcgcacgtgtgaaaatgcaggtaactatgtca
ctaagctccttggttggtacgagcgcttcttttagcgaacagtctcttcgtcgtgcgttg
aaaacagtcttagtttatgctgaatccgatacagacttacaggaaacttctttcccagag
caagtgcaagatttattattcaatctgcatatgatcctctccgatacagtaaaaatgaaa
gagtatcaagaggacccagaaatgttactcgacctaatgaatcgcatagcaaaaggatat
caaaacaatccagatttgcggcttacatggctggaaaatatggctaaaaagcatcgtgaa
cgtgccaaccacacagaagcggcaatgtgttatatacatggggctgcattagtttcggaa
tatctgagtatgctagaatcgcaaacccatttgcctattggcgcagtaagttttcaacgc
atatcaccaaatacctttatggaatctgcggtgtcggacgatgttcttagtccaggcgaa
gatggaatctgtctgggcaatcacttcactgagaccggattaaaggcattgctcgaagag
gcatccaattcttttcaagtcgcaggcatgtatgaagctatgaacgaagtttataaaata
ttacttcctatatgtgaggcgaaccgggagtttcacaagcttggaaaaattcatggcaaa
ctgcaagaagcttttaatcgaattgcacagttacatggcaagcgagtatttggaacttac
tttcgtgttggcttctatggagcaaagtttggagatctggatcaacaagaattcatttac
aaagaaccaacattaacaaagttgccagaaatatttagtcgacttcagaacttttatacg
gaaaggtttggtccggattctgtgcatattattaaggactccaataatttcgacccaaat
acattagatccggaaaaggcgtatatacaaataacttatgttgaaccattcttcgaaacc
tatgaaatgcgtcatcgtgaaacttactttgaacgaaattttaatataaaacgatttata
ttttcaacgccgttcactaaaagcggaaaagctcatggagaattacatgagcaatgtaag
cgaaaaacaatattaacaactgcaaaccacttcccttacgttaaaactcgtatccaagta
attaatagaactcaatttcaattggagccgattgaagttgccatagaagacatccaaaag
aagacattggaattagctgcagctacaaatcaggagccggccgacccaaaaatattacaa
atggtcttacagggttgcatcgggactactgttaatcagggacctatggaaatggctagc
gtatttctgtcaaatttatctgacggaacgactataccaacaaagcatcaaaataaatta
cggttgtgctttcgcgaattttcaaaacgatgcgctgatgccttgaaaaaaaatagaaat
ctaatattatccgaccaaaaagattatcagcgagagttagaacgtaattatgagcgcttc
gtggaacgactgatgccgcttatcacactttcatcagcacaaacacaaggagttgtaaaa
gctaatgcgttccaaaacaagagcacaccacttaaatggtaa

DBGET integrated database retrieval system