KEGG   Drosophila mojavensis: Dmoj_GI16605Help
Entry
Dmoj_GI16605      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform D
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00480  Glutathione metabolism
dmo00590  Arachidonic acid metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Dmoj_GI16605
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmoj_GI16605
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dmoj_GI16605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin PTP2
Motif
Other DBs
NCBI-GeneID: 6586515
NCBI-ProteinID: XP_002012126
FlyBase: FBgn0139353
UniProt: B4L982
Position
Unknown
AA seq 197 aa AA seqDB search
MAGRSLVSLMFGALAAAVGTYIYFTNQVDMSDGDYKNAASIYEFNVKDTHGNDVSLEKYK
GQVILIVNIASKCGLTKNNYKKLTDLKEKYGERGLTILNFPCNQFGSQMPEADGEAMVCH
LRDSKADIGEVFAKIDVNGDNAAPLYKYLKAKQSGTLGSGIKWNFTKFLVNREGVPINRY
APTTDPMDIAKDIEKLL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcgttcgctggtatcccttatgtttggtgcactggctgctgccgtgggcacc
tacatctacttcacgaatcaagtcgacatgtcggacggtgattacaagaacgcagcctcg
atctacgagttcaacgtgaaggacacccatggaaacgatgtctccctggaaaagtataag
ggccaggttatccttatcgtcaatattgcttcaaagtgtggtttaactaaaaataactac
aagaagttgaccgatctgaaggagaagtatggcgaacgcggactgaccatcctgaacttc
ccatgcaatcaatttggctcccaaatgccagaggccgatggggaggccatggtctgtcat
cttcgtgactctaaagcagacattggcgaagtctttgccaagattgatgtgaatggcgat
aatgcagcgcctttgtataagtacttgaaggccaagcaatctggcaccttgggcagcggc
atcaaatggaacttcaccaaattcctggtgaacagggagggcgttccaatcaatcgatat
gcacccactaccgatcccatggacattgccaaggatatcgagaaactattgtag

DBGET integrated database retrieval system