KEGG   Drosophila mojavensis: Dmoj_GI16688
Entry
Dmoj_GI16688      CDS       T01062                                 

Name
(GenBank) uncharacterized protein
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00030  Pentose phosphate pathway
dmo00052  Galactose metabolism
dmo00230  Purine metabolism
dmo00500  Starch and sucrose metabolism
dmo00520  Amino sugar and nucleotide sugar metabolism
dmo01100  Metabolic pathways
dmo01250  Biosynthesis of nucleotide sugars
Module
dmo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
dmo_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI16688
   00030 Pentose phosphate pathway
    Dmoj_GI16688
   00052 Galactose metabolism
    Dmoj_GI16688
   00500 Starch and sucrose metabolism
    Dmoj_GI16688
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI16688
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmoj_GI16688
Enzymes [BR:dmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dmoj_GI16688
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: EDW17092
FlyBase: FBgn0139436
UniProt: B4L9P4
AA seq 560 aa
MSLNVETKQTTPYEGQKPGTSGLRKKVKVFTQPNYTENFVQCILEANGTALVGSTLVVGG
DGRYYCKEAAELIIRICAGNGVAKLLVGQNGILSTPAVSSLIRHNKALGGIVLTASHNPG
GPENDFGIKFNCENGGPAPDAFTNKIYQLSTTIKAYTLVPSLQIDISKVGVSNYDIGGKP
FVVEVIDSVANYVRHMEEIFDFGKLHDFVSGKSNGKPLKMRIDSMNGVTGAYVREIFLNR
LGATEASVVHTTPLPDFGGLHPDPNLTYAKDLVETVAKGDYDIGAAFDGDGDRNMIIGSK
AFFVTPSDSLAVIAHYLDAIPYFQKNGVQGFARSMPTASAVDLVGKKLGKEVFEVPTGWK
YFGNLMDAGRLCLCGEESFGTGSNHIREKDGIWAVLAWISVMQHTGKSIEDILKQHWSVY
GRNYFTRYDYEECDLEPCNEMMATMEKNITAAEFVGKSFSSEGKTYKVKEADNFSYTDPV
DKSLATKQGLRIVFDDGSRIVMRLSGTGSSGATVRLYIDSYEKQNVLGQASVMLKPLIDI
ALEISQLPKFTGRNAPTVIT
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtctctaaacgtggaaacgaagcaaactacaccatatgaaggccaaaaaccaggcact
agcggactacgcaaaaaagtgaaagtattcacgcagcccaactacacggaaaattttgta
caatgcattctggaagctaatggtacagctctggtagggtcaacgttggttgtaggaggc
gatggacgttactactgcaaggaggcagctgaactcattattcgcatctgtgcaggcaat
ggagtggccaagctgctggtgggtcagaatgggatactctcgacgcctgccgtctccagc
ttaatacgccacaacaaagcgctgggtggtattgtgttgactgcgtcccacaatcctggc
ggtccggaaaatgatttcggaattaagtttaactgtgagaatggaggacctgcgcccgat
gccttcaccaataagatttaccaactttcgactactataaaggcttacacactggtgcca
agcttgcagattgacatctcaaaagtgggcgtcagcaactacgacattggcggcaagcct
tttgtggtggaagtcattgactctgtagctaactatgtacgtcacatggaggagatcttt
gatttcggcaagctgcacgattttgtcagcggcaaatcaaatggaaagcccctaaagatg
cgcatcgactccatgaatggtgtaaccggtgcctatgtgcgtgagatctttctgaaccgt
ttaggtgctacggaggcgtctgtggttcacaccactccactgcccgactttgggggactt
catccagatccaaatttaacttacgctaaggatttagtggagaccgtggccaaaggtgat
tatgatattggcgctgcttttgatggcgacggcgatcgcaacatgataatcggcagcaag
gccttctttgtaacgcccagcgactctttggcggtcatagcgcattatctcgatgcaatc
ccgtatttccaaaagaatggagtacaaggctttgcacgcagtatgcccactgcctcagct
gtcgatctagtaggcaaaaagctgggaaaagaggtattcgaggtacccaccggctggaag
tattttggtaatcttatggacgcaggacgtctctgtctgtgtggcgaagagagtttcggc
actggctccaatcacatacgagagaaagatggtatttgggcggtgctcgcttggatttcc
gttatgcaacacactggcaagagcattgaggacattcttaagcagcattggtccgtttat
ggacgcaactacttcacacgctacgattatgaagaatgcgatttggaaccctgcaacgaa
atgatggccactatggagaaaaacatcacagctgcagaatttgtcggcaagagcttttcc
agcgagggcaagacctataaagtcaaggaagcggacaacttcagctacacagatcccgtg
gacaaatccttggccaccaagcagggattacgtattgtattcgacgatggcagccgcatt
gtgatgcgtcttagtggcacaggcagctcaggagctaccgtacgcttgtacatcgactct
tatgagaaacagaatgtgctgggccaggcgagtgttatgctgaaaccgctaatagatatt
gcattggaaatctcacagcttccgaagtttactgggcgcaatgcacccactgtcatcaca
taa

DBGET integrated database retrieval system