KEGG   Drosophila mojavensis: Dmoj_GI16833Help
Entry
Dmoj_GI16833      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00790  Folate biosynthesis
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI16833
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     Dmoj_GI16833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 GreA_GreB Epimerase
Motif
Other DBs
NCBI-GeneID: 6586577
NCBI-ProteinID: XP_002012188
FlyBase: FBgn0139580
UniProt: B4L9E4
Position
Unknown
AA seq 235 aa AA seqDB search
MSAGRVFIYGGKGALGSACVDHFKAKDFWVGSIDLSENDKADISIVVPRDSSWEEQESSV
VSQVGESLAGQKLDAVICVAGGWAGGNAKKDLAKNADLMWRQSVWSSCISATLAAHHLKT
GGLLALTGAKPALAGTPGMIGYGMAKAAVHQLTRSLAGENSGLPDNALVVSILPVTLDTP
MNRKWMPKADFSSWTPVTEVAELFEKWTQSKDRPKSGSLLQLITKNGITELIPAE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaggtcgagttttcatctatggggggaaaggagccctcgggtccgcctgcgtc
gatcacttcaaagccaaagacttttgggttggcagcattgatttgagtgaaaacgacaaa
gcagacattagcattgttgtgccacgcgattcgagctgggaggagcaggaatcctctgtg
gttagccaggtgggcgaatctttggctggccagaaactggatgctgtgatctgtgtagcc
ggcggctgggcaggtggcaatgccaagaaagatctggcgaagaatgcggatctgatgtgg
cggcaaagcgtctggagcagctgcatctcagccacattggcagcacaccacctgaagaca
ggtggtctgctggcactgaccggcgccaagcctgccctggctggtactcctggcatgatt
ggctacggcatggccaaggctgcagtgcatcagctaacacgctcgctggcgggcgagaat
tccggtttgcccgataatgcgctggttgtatccattctacctgttaccctagacacaccc
atgaaccgcaagtggatgcccaaagctgacttcagcagctggacacctgttaccgaggtc
gccgaactctttgagaaatggacacagtccaaggacagacccaaaagcggttccctgctg
cagctgatcacaaagaatggcattacggaactcattccggcggagtag

DBGET integrated database retrieval system