KEGG   Drosophila mojavensis: Dmoj_GI16858Help
Entry
Dmoj_GI16858      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00562  Inositol phosphate metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI16858
   00562 Inositol phosphate metabolism
    Dmoj_GI16858
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dmoj_GI16858
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dmoj_GI16858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6586619
NCBI-ProteinID: XP_002012230
FlyBase: FBgn0139604
UniProt: B4L9I6
Position
Unknown
AA seq 464 aa AA seqDB search
MRLLLLLMMACLAYAQQQQDYCFGKDTERPQTRQFSSKTAYQIVKGTNMDKQYQVPGCEP
KKMWIYHRHGTRLPTPGTIREAPRLEELRDAIIKNYRVLRTKPDENALCLIDLTAIQMWK
WNASITVDIEEHLTSQGYEDMRGTAKLYQRYYPTVLPSKYNDSYYLFRHTDTQRTTESFK
GFAEGLFGDASVATAADIPEKDLLLRPYDYCSDFKDKNYKGEGSEYQKFRTSAIWNRTMA
DITKRLGFTFLAEDDIKLMFDICRYEQAWRVDRTSVWCGVFLPEQVTVLEYAEDLKYYYG
SGYGFEENTRFNCRAVQDMVARLSSPVSPHVVAYFAHSSGLQTLLTALGINKDDIKLRAD
NFDSMGSRRWKTSQLGPFAANFVGVKYHCPASLEKEKVVFFLNQNAVQLDWCNVGLCNWS
DVLAQYKTILEADCDEYYCRSAASVGRASMLVTGLIAAIVYLMH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctattgctcctgatgatggcctgcctggcctatgcccagcagcagcaggac
tattgctttggcaaggatacggagcggccacagacccgccagttcagctcgaagacggcc
taccagatcgtcaagggcaccaacatggataagcagtaccaggtgcccggctgtgagccg
aagaagatgtggatctaccacagacatggcacacgtctgcccacaccaggcaccatccgg
gaggcgcctagactagaggagctacgcgatgccattatcaaaaactatcgcgtgctccgc
accaagcccgatgagaatgctctctgcctcatcgatctcactgccatccagatgtggaaa
tggaatgcgagcattacggttgacattgaggagcatttgaccagccagggctacgaggac
atgcgcggcacagccaagctctaccagcgctactatcccacagtgctgcccagcaaatac
aatgatagctactatttgttccgtcacacggacactcagcgcaccacggagagcttcaag
ggctttgccgagggtctcttcggagatgcgagtgtggccaccgctgcggatataccggaa
aaggatttgctgctgcgtccctatgactactgctcggacttcaaggacaagaactacaag
ggcgagggctccgagtatcagaaatttcgtaccagcgccatctggaatcgcaccatggct
gatattacgaaacgacttggcttcacattcctggccgaggatgacatcaaattgatgttc
gatatctgccgctatgagcaggcctggcgggtggatcgcacgagcgtctggtgcggcgtc
ttcctgccggagcaggtgaccgtgctggaatatgccgaggacctgaagtactactatggc
tcgggctacggcttcgaggagaacacccgcttcaattgccgtgccgtccaggacatggtc
gctcgtctgagcagtcctgtttcgccacatgttgtggcctacttcgcgcactcgtcgggc
ctgcagacgctgctcacggcgctgggcatcaacaaggatgacatcaagctgcgagcggat
aacttcgattccatgggcagtcgccgctggaagaccagccagctgggtccatttgccgcc
aactttgtgggcgtcaaataccattgccccgcctcgctggagaaggagaaggttgtcttc
ttcctcaatcagaatgccgttcagctggactggtgcaacgtgggcctgtgcaactggtcc
gacgtactcgcccagtacaagaccattttggaggccgactgtgatgagtattactgtcga
tcggctgcatcggtgggacgtgcctcgatgctagtcaccgggctaatcgctgccattgtc
tacttaatgcattag

DBGET integrated database retrieval system