KEGG   Drosophila mojavensis: Dmoj_GI17643Help
Entry
Dmoj_GI17643      CDS       T01062                                 

Gene name
Dmoj_Adh2
Definition
(RefSeq) alcohol dehydrogenase-2
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00071  Fatty acid degradation
dmo00350  Tyrosine metabolism
dmo00830  Retinol metabolism
dmo00980  Metabolism of xenobiotics by cytochrome P450
dmo00982  Drug metabolism - cytochrome P450
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI17643 (Dmoj_Adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    Dmoj_GI17643 (Dmoj_Adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dmoj_GI17643 (Dmoj_Adh2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmoj_GI17643 (Dmoj_Adh2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmoj_GI17643 (Dmoj_Adh2)
   00982 Drug metabolism - cytochrome P450
    Dmoj_GI17643 (Dmoj_Adh2)
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dmoj_GI17643 (Dmoj_Adh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR ThiF Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 6576952
NCBI-ProteinID: XP_002002929
FlyBase: FBgn0012567
UniProt: P09369
Position
Unknown
AA seq 254 aa AA seqDB search
MAIANKNIIFVAGLGGIGFDTSREIVKRGPKNLVILDRIENPAAIAELKALNPKVTVTFY
PYDVTVSVAETTKLLKTIFDKLKTVDLLINGAGILDDHQIERTIAVNFTGTVNTITAIMS
FWDKRKGGPGGVIANVCSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSIN
PGITKTTLVHKFNSWLDVEPRVAELLLEHPTQTTLQCAQNFVKAIEANQNGAIWKVDLGT
LEAIEWTKHWDSHI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgctaacaagaacatcatattcgtcgctggactcggtggcattggattcgac
accagtcgcgagattgtcaagaggggaccaaagaacctggtaatccttgatcgcattgag
aacccagcggctattgccgagctgaaggcactcaaccccaaggtgaccgtcacgttctat
ccctatgatgtaaccgtctcggtagcagagaccacaaagctattgaagacgatcttcgac
aagctgaagacagtcgatctgctcatcaatggagcaggcatcctggacgaccaccagatc
gagcgtaccattgcggtgaacttcacaggcacagtgaacaccatcacggccatcatgtcc
ttctgggacaagcgtaagggcggcccaggcggtgtcattgcgaacgtctgctcggtgact
ggcttcaatgccatctaccaggtgcctgtgtactccgcatccaaggcagctgctctcagc
ttcaccaattctttagccagactggcgcccattaccggtgtaactgcctactccatcaac
cctggcatcacgaagacaactctggtccacaagttcaactcgtggctggatgtggagcct
cgtgtggccgagctgctgctggagcatcccactcagacaactctgcagtgcgcccagaac
tttgtcaaggctattgaagccaaccagaatggcgccatctggaaagtggacttgggtacc
ctggaagccattgaatggaccaagcactgggattcgcatatctaa

DBGET integrated database retrieval system