KEGG   Drosophila mojavensis: Dmoj_GI17729
Entry
Dmoj_GI17729      CDS       T01062                                 
Name
(GenBank) uncharacterized protein
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00280  Valine, leucine and isoleucine degradation
dmo00650  Butanoate metabolism
dmo01100  Metabolic pathways
dmo04146  Peroxisome
Module
dmo_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dmoj_GI17729
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmoj_GI17729
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmoj_GI17729
Enzymes [BR:dmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Dmoj_GI17729
SSDB
Motif
Pfam: HMGL-like FlpD
Other DBs
NCBI-ProteinID: EDW12542
FlyBase: FBgn0140470
UniProt: B4KJT9
AA seq 329 aa
MIIPRYLVRPLFQWSFLGRSSRFMSQLSQDIVRIVEVGPRDGLQNEPKLLPAAIKIELIN
RLSETGLQTIEATSFVSAKWVPQMGDNSQVLRGIRRAPGISYPVLTPNLKGFESALEAGA
EEVAVFGAASDAFSLKNVNCTAAEAIERFKPVLEAAKKNGIRVRGYVSTVVGCPYEGAVP
PQAVVKVVTALHEMGCYEISLGDTIGVGTPGSMRKMLDEVTRAVPAQQLAVHCHDTYGQA
LSNILTSLEYGIRVVDASVSGLGGCPYARGASGNAATEDVVYMLHGMGMNTGVNLDKLIE
VGRYICTELGRPTESKVNRAWKGPQGKKL
NT seq 990 nt   +upstreamnt  +downstreamnt
atgataattccacgatatttggtgcgtcctctattccaatggtctttccttggcagatct
tcacgatttatgtcccagctgtcgcaggatatcgtgcgcattgtggaggtgggaccacgc
gatggtcttcaaaacgagccgaaattgctgccggctgctataaaaattgagcttataaat
cggctgtcggaaacgggcttacaaacaattgaggccaccagttttgtgagcgccaagtgg
gtgccccaaatgggcgacaattcgcaggtcttgcgtggcatacggcgtgcaccaggcatt
agttatcctgtgttgacgccaaatctgaaaggatttgagagtgctttagaggctggcgcc
gaggaagtagctgtatttggtgccgcttcggatgcattttcacttaaaaatgtcaactgt
acagcggcagaggccatcgagcgcttcaagcctgtcctcgaagctgctaagaaaaatgga
attcgtgtgcgaggctacgtttccactgtggtaggctgcccctacgagggagctgtgccg
ccccaggctgtggtcaaggtggtaactgcgctgcatgaaatgggctgctacgagatctcg
ctgggcgacactattggcgtgggaactccaggtagcatgcgcaagatgctggatgaggtg
acacgcgccgtacctgcacagcaactggccgtgcactgccatgatacctacggccaggcg
ctatcgaacattctgacttccttggagtacggtataagagttgtggatgcctctgtctct
ggcctgggcggctgtccctatgcacgtggcgcctccggcaatgcagctactgaggatgtc
gtctatatgctgcacggaatgggtatgaatacgggtgtcaatctggataaactcattgaa
gtgggccgctacatatgcacggaattgggcagaccaactgaatccaaggtgaatcgtgcc
tggaaagggccgcagggtaaaaagttataa

DBGET integrated database retrieval system