KEGG   Drosophila mojavensis: Dmoj_GI18080Help
Entry
Dmoj_GI18080      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08738  cytochrome c
Organism
dmo  Drosophila mojavensis
Pathway
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI18080
   04215 Apoptosis - multiple species
    Dmoj_GI18080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6577819
NCBI-ProteinID: XP_002003751
FlyBase: FBgn0140820
UniProt: B4KG54
Position
Unknown
AA seq 104 aa AA seqDB search
MGADAENGKKIFVQKCAQCHSYEVGGKHKQGPNLGGIVGRKCGSAPGYKYTEANIKKGIA
WTEGNLDEYLKDPKKFIPGTKMVFPGLKKAEDRADLIAFLKTNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgatgcggagaatggcaaaaagattttcgttcagaaatgcgcacaatgccac
tcctacgaagtgggaggaaagcacaagcagggtcctaatcttggcggaattgttggccgc
aaatgcggttctgcccctggctacaaatatactgaagctaacatcaaaaagggtatcgct
tggacagaaggcaatctggacgagtatctgaaggatccaaagaaatttattcccggcacc
aagatggttttccccggactcaaaaaggccgaggatcgcgctgatttgattgcatttctc
aaaacaaacaaatag

DBGET integrated database retrieval system