KEGG   Drosophila mojavensis: Dmoj_GI18264Help
Entry
Dmoj_GI18264      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI18264
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI18264
Ubiquitin system [BR:dmo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmoj_GI18264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ubiquitin Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 6578180
NCBI-ProteinID: XP_002004097
FlyBase: FBgn0141003
UniProt: B4KJF9
Position
Unknown
AA seq 481 aa AA seqDB search
MPSFKVKVKWGRELYPDIDVNTDEDPILFKAQLFALTGVQPERQKIMCKGGILKDDEWNL
QLKDGAVVLLLGSKDKVPEMPQTPVKFIEDMNDAEAATAMRLPAGLTNLGNTCYMNATVQ
CLRAVPELRKALEKFQPDGSDATSYAFTISSAMKIVFAQMEKGTTITPIVLLQALHRASP
QFAQTGENGTYRQQDANECWSEILKMLQQKLLPLNQELGEATDKKVHNSFIEQFFGGTFE
VKMTADEAPDEPVTVSTENFLQLSCFISMEVKYMQSGLKSKMKEQLVKNSNTLGRDAHYT
RTYLISRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPDLQNKLCPMRA
KFKDHEDKKMDVESQINKTSKSLEVDGEDDETKYEPFWFDNDLGSNNSGYYTLKAVLTHK
GRSSSSGHYVAWVRSNGDVWYKFDDDDVTSVTTDEILRLSGGGDWHCAYVLLYGPKRLEK
C
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcttttaaagttaaagtcaagtggggccgtgaactatatccggatattgatgtc
aatactgatgaagacccaatattatttaaagctcaactttttgcattaacgggggttcaa
ccggaacgccaaaaaataatgtgtaaaggtggcatacttaaagatgatgaatggaattta
caattaaaagacggtgccgtagtcttattattgggttctaaggataaagtacccgaaatg
ccccaaacaccagttaaatttattgaagacatgaacgacgcagaagcagccaccgcgatg
cgcttacctgccggtttaactaacctcggcaatacatgttacatgaatgccactgtacaa
tgtttaagggctgttccggaactacgaaaagctttggaaaaatttcaacccgatggctct
gacgccacttcatatgcatttactatttcatcagctatgaaaatagtgtttgcacagatg
gagaagggaacaactattacaccaattgtgttgctgcaagccctacatagggcatcaccg
cagtttgcacagactggagaaaatggcacctatcggcagcaagatgccaatgaatgttgg
tctgaaatactgaaaatgttacagcaaaaacttttaccattaaaccaagagttaggtgaa
gctaccgataaaaaagttcataactcattcattgaacaattctttggtggaacttttgaa
gtcaaaatgactgcagatgaagctcctgatgagcctgttacggtttcaacagaaaatttt
ttgcagctcagttgttttatatcgatggaagttaagtatatgcaaagcggcctcaaatcg
aaaatgaaagagcaattggtaaagaactcgaatacgctgggtcgtgatgcacattataca
agaacttatttgataagtcgacttccagcatatcttaccgttcaatttgtcagatttcaa
tataaaggaaaggaaggcataaatgcaaaagtattgaaagatatcaaatttccaattgat
ttcgatgcatttgagctgtgtacgcccgatttacagaacaaactatgcccaatgcgagcc
aaatttaaggatcacgaagacaaaaaaatggatgtcgaatcacagataaataagacatcg
aaatctttggaagtcgacggagaagacgatgaaacgaaatatgagccattctggtttgat
aatgatttgggcagcaacaactctggttattatacacttaaagctgtgctaactcataag
ggtcgctcgagttcatctggtcattatgtggcctgggtacgctcaaatggtgatgtttgg
tataagttcgacgacgacgatgtgacatctgttaccactgatgagatattacgactgtct
ggaggtggtgactggcattgcgcttatgttctgttgtacggacctaaacgtttagaaaag
tgctag

DBGET integrated database retrieval system