KEGG   Drosophila mojavensis: Dmoj_GI19561Help
Entry
Dmoj_GI19561      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmo01002]
    Dmoj_GI19561
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dmo03110]
    Dmoj_GI19561
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     Dmoj_GI19561
Peptidases and inhibitors [BR:dmo01002]
 Serine peptidases
  Family S8: subtilisin family
   Dmoj_GI19561
Chaperones and folding catalysts [BR:dmo03110]
 Intramolecular chaperones
  Subtilisin family
   Dmoj_GI19561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPPII Peptidase_S8 TPPII_N TPR_14
Motif
Other DBs
NCBI-GeneID: 6578623
NCBI-ProteinID: XP_002004531
FlyBase: FBgn0142298
UniProt: B4KSW9
Position
Unknown
AA seq 1358 aa AA seqDB search
MASDLSGIVESSFPTAALVPKAETGVLNFLQKYPEYDGRDVTIAIFDSGVDPRATGLETL
CDGKTVKVIERFDCSGCGDVDMSKKLIPNENGIVKGLSGRSLKFTPQLLALNTDKERAVR
VGLKSFNDLVPAKVRDNIVAQAKFKSWDKPHKTATANANRKIVEFESQNPGEASKLPWDK
KIIKENLDYELEMLNSFEKMYSDVRVSYDCVLMPTENGWLTIIDTTEEGDLTKALHIGEY
SRTHETKNVDDFLSISVNVHDDGNVLEVVGMCSPHGTHVASIASGNHNSRDIDGVAPNAK
IVSLTIGDGRLGSMETGTALVRGIMKVMELCREGRRIDVINMSYGEHSNWSNSGRIGELM
NEVVNKYGVVWVASAGNHGPALSTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMREKLPG
NVYTWTSRDPCIDGGQGVTVCAPGGAITSVPQFTMSKSQLMNGTSMAAPHVAGAVALLIS
GLKQQQIEYSPYSIKRAISVTANKLCYVDPYAQGHGLLNVEKAFEHLVEHRQSKDNMLRF
SVRVGNNNAKGIHLRDGVQRKFIDFNVNIEPVYFNDKEVDPKEKFNFNVRLSLVPSQSWV
QCGAFLDLSYGVRSIVVRIDPTGLQPGVHSAVVRAYDTANVQKGPLFEIPVTVVQPHVLE
DTQSTPIFEPFSNRADKSVEFQPNTIQRDFIQVPDKSTWAVLRMRLTDPNRGNDVGKFFL
HTNQLLPNQSCRKLETMKIIGVSSEFDATATFRVKANKILELCIAKYWSNHGQSHLKYSL
EFHGVTALNPNAYVMHAGRGIHKLELDALVSEEVQPSLQLKTAAVVLKPSEAKISPLSAT
RDVIPEGRQIYQNMLVYNLNVNKAADVALYAPLFNDLLYEAEFESQMWMLFDVNKTLLAT
GDAHSHTFFTKLEKGEYTVRLQVRHEKRELLEKISEANLIAVYKLANMISLDFYDSYNQG
IVGGRKISSTKVRDTSKVIYVAPISQEKLNKANLPSPCAWLSGNLILPKDEGGRRVDLHS
FTYILNPAEKKSSSNGAANGAAASNANPAAAAASTNGVKPKPASTIQEEASAANSAGGDG
VTSQTDGPANGCSGTPSSPQKGKAGADDYAESLRDFQCSHIAKCDLEKAEKIYNDVIAAH
PKHLPAHLQLIQNIESSELKSLLPFAFVAAQQNRSKEGDNANADKPKEDLQKQRSALERI
VKLADIVINETDADALLSYYGIKNDTRSDAAKIKTNMDKQKNNLIEALVKKGIALAKVYV
LDDNVKDHLAELNDVYTEIIKFIDANDSKAIQFSIWHAFAHNHYGRMYKYVTKMIEDKRV
RELYDEMAAINFAMGYEHTKPLIDRMAISYFPGSFRLF
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgacttaagcggcattgtcgagtcatcatttcctacggcagcattggtgccg
aaggcggagacgggcgtgttgaactttttgcagaaatacccagaatacgatggccgcgat
gtgacaatcgccattttcgattctggtgtagatccccgtgcaacgggtcttgaaactctg
tgcgatggcaaaacggtgaaagtaattgagcgcttcgattgctcgggttgcggcgatgtc
gatatgagcaagaaattgataccgaatgagaatggcattgtaaagggcttgtctggtcgt
tcgctgaagttcactccccaactgcttgctctcaacacagacaaggagcgcgcagtacgc
gtgggcttaaagagcttcaacgacttggtgccggccaaagtgcgcgacaatattgtcgcc
caggcgaagtttaagagctgggacaagccacacaaaactgctacggcaaatgccaaccgc
aaaattgttgaatttgaatctcaaaatcctggagaagcgtccaagctgccgtgggacaag
aagataatcaaggagaaccttgactatgaattggaaatgctcaactcttttgagaagatg
tacagtgatgttagggtctcatatgactgcgttcttatgccaactgaaaatggctggctg
accatcatcgataccacagaggagggtgatctgacaaaagcattgcacattggcgaatat
tccaggacgcatgagacgaaaaatgtggatgatttcctctcgatttctgtcaacgtacac
gacgacggcaatgtgctggaagttgtgggcatgtgctctcctcatggcactcacgttgcg
tctattgcgagtggcaaccacaactcgagagacattgatggagttgcacccaatgctaaa
attgtgtcgttgaccattggcgacggtcgcttgggttcaatggaaaccggtacagcgctg
gttcgcggcataatgaaggtgatggagctctgtcgcgagggtcgccgcatcgatgtgatc
aatatgagctatggcgagcactcgaactggtctaactccggtcgcattggtgagctgatg
aacgaggtggtcaataagtacggcgttgtctgggtagcctcggcgggcaatcatggaccg
gctctcagcacagttggtactcctcctgacatcagtcagccgagcctgataggtgtgggt
gcctacgtctcgccacagatgatggaggccgagtatgcgatgcgtgagaagttgcctggt
aatgtttacacctggacatcacgcgacccttgcatcgatggcggacagggcgtcacggtg
tgcgcaccagggggcgccatcacatccgtgccacagttcaccatgagcaaatcgcagctg
atgaacggcactagcatggcagcacctcatgtggccggtgcagtggccttacttatttcc
gggctaaagcaacagcagattgagtattcgccgtatagtattaagcgggcgataagcgtc
acggccaacaagttgtgctatgtggatccctacgcccaaggccacggtctactcaatgtg
gagaaggcatttgagcatttggttgagcatcggcaatccaaggacaacatgttgcgcttc
tctgtgcgcgtgggcaacaacaatgcaaagggcattcatcttcgcgatggcgtgcagcgc
aagttcattgacttcaatgtcaacattgagcccgtctatttcaatgacaaggaagtggat
cccaaggagaaatttaatttcaatgtgcgcctcagtcttgtgccctcgcagtcttgggtg
cagtgtggcgccttcctggaccttagctatggagttcgctcgattgttgttcgaattgat
ccgactggcttgcagccaggtgtgcacagtgctgtcgtccgtgcctatgatacggccaat
gtgcagaagggcccattgtttgagataccagttacagtggtgcagccccatgtattggaa
gatacccaaagtactcccatatttgagccgttttcaaatagggctgataaaagcgttgag
tttcaacccaatacaattcaaagggactttattcaagtgccagacaagtccacctgggca
gtgctgcgcatgcgcctaactgatcccaaccgtggcaacgacgttggcaagttcttctta
cacacgaatcaattgttaccaaatcaatcttgtcgcaagctggaaacaatgaagattatt
ggtgtcagttcggaatttgatgccacggctaccttccgtgtgaaggccaacaaaatactg
gagctgtgcattgccaagtactggtccaatcatggccagagtcatttgaaatacagtctc
gagtttcacggcgtgactgcactcaatccaaatgcatatgtcatgcacgctggtcgtggc
atacacaagttggaacttgatgcactggtgtccgaggaggttcaaccatcgctgcagctg
aagactgctgcggtcgtgctcaaaccaagcgaggcaaagatctcgccattgagtgccaca
cgtgatgtcatcccagagggcaggcagatctatcagaatatgctcgtctacaatctgaac
gtaaacaaggcagcggatgtggcgttgtatgcaccgctgtttaacgatttgctttacgaa
gcggaatttgagtcgcagatgtggatgctgttcgatgttaacaaaaccctgctggccacc
ggcgacgcgcactcccacacgttcttcacaaagctggaaaagggagaatatactgtgcga
ctgcaggtgcgccacgagaagcgtgagctgctggagaaaatttcagaggccaacctcatt
gcggtgtacaagttggccaatatgatctctctagatttttacgatagctacaaccagggc
attgtcggtggccgtaaaatatcgtccacaaaggtgagagacaccagcaaagtcatctac
gttgcacccattagtcaggaaaagctgaacaaggccaatttaccgtcgccgtgcgcctgg
ttaagcggcaatctaatcctccccaaggatgaaggcggccgtcgcgttgacctccattcg
ttcacatacatactcaatccggctgagaagaaatcttcctcaaatggcgccgccaatgga
gctgctgccagcaatgccaatccagcagcggcagctgcttcaacaaatggagtcaagccg
aagccagcttccaccatccaggaggaagccagcgctgcaaattcagctggtggcgatgga
gtcacaagccaaactgatggtcccgccaatggttgcagtggtacgcccagttcgccacaa
aagggcaaagctggcgccgatgattatgctgagagcctgcgagatttccaatgctcgcac
attgccaagtgtgatctggaaaaggctgagaagatttacaacgatgttattgccgcacat
cccaagcacttgccggcccatctgcagttaattcaaaacatcgagtcgagcgaattgaag
agcctattgccgttcgcatttgtcgctgcccaacagaacagaagcaaagagggcgataat
gccaatgcggataagccgaaggaggatttgcagaagcagcggtcggccttggagcgcatt
gtcaagctggctgacattgtaatcaatgaaactgatgccgatgccctgctttcttactat
ggtattaagaacgacacccgttcagatgcagctaagatcaagacaaatatggataagcag
aagaataatctgattgaagcattggtcaagaagggtatcgccctcgccaaggtctatgtg
ctcgatgataatgtgaaggatcatttggctgagttgaatgacgtctacaccgagattatc
aagtttatcgacgccaacgatagcaaggcaatccaattctccatttggcatgcttttgcg
cacaatcactatggacgcatgtacaagtacgtgacaaagatgattgaggacaaacgcgta
cgggaactctacgatgagatggctgcaatcaattttgcgatgggatacgagcatacaaag
cccctcatcgatcgcatggctatcagctacttcccgggcagcttccgtttgttctaa

DBGET integrated database retrieval system