KEGG   Drosophila mojavensis: Dmoj_GI19876Help
Entry
Dmoj_GI19876      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dmoj_GI19876
Protein kinases [BR:dmo01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   Dmoj_GI19876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 6578426
NCBI-ProteinID: XP_002004338
FlyBase: FBgn0142613
UniProt: B4KR86
Position
Unknown
AA seq 419 aa AA seqDB search
MRIFPVRLSAASSSMASLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSFIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLEYEKVEPTHENLQKFVRDLDLIR
NRHNDVVQTMAQGVIEMKENEGGNVEAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGS
SPHSQGRHIGCLDPACDISDVVRDAYENARFLCDQYYLTSPALEIQQHSSTDEGIPIRTV
YVPSHLYYMLFELFKNSMRAVVEHHNQDSCDSLPPLKVHICRGKEDICVKISDQGGGIPR
SQSDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDA
IIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLNATISRRYSDLE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatttttcctgtacgcctctcggccgcctcgtcctcgatggcgagcctggccaaa
atgttggatttctactcgggcttcaatccgtcgccgctgtcaataaaacagtttatggat
tttggtcaaaatgcatgcgaaaagaaatcctttatatttctgcgcaaggagctgcccgtg
cggctggcgaacatcatgaaggagattgctttactgcccgacaatctgctgcacacacga
tccgtgagcgaggtgagctcgtggtatgtgaagagcttcgaggatgtgctggagtacgag
aaggtggagcccacgcatgaaaatctgcaaaaatttgttcgcgatttggatctcattagg
aatcgtcacaatgatgtggtgcagaccatggcgcagggcgtcatcgagatgaaggagaac
gagggcggcaatgtggaagcgcccacggagagctccatacaatatttcctcgatcggctc
tacatgtcgcgcattagcatacgaatgctgatcaatcagcacactctgctgtttggctcc
agtccgcattcgcagggccgtcacattggctgcctggatcccgcctgcgatatctccgat
gtggtgcgcgacgcctacgagaacgcgcgcttcctctgtgatcagtactacttgaccagt
ccggctctggagatccagcagcacagctcgaccgatgagggcatacccatacgcactgtc
tacgtgccttcgcatttgtactatatgctctttgagctgtttaagaactcgatgcgcgcc
gttgtcgagcatcacaaccaggacagctgcgactcgctgccgccgctcaaggtgcacatc
tgtcgcggcaaggaggacatatgcgtcaagatctccgatcagggcggcggcatcccgcgc
tcccagtccgatcagctgttcaagtacatgtacagcacggcgcctcagccatccaagtcg
gatctgcacacggtgccgctggctggctatggctacggcctgcccatctcccggctctat
gctcgctatttccatggcgacattgtgctgctgtcctgcgagggctttggcaccgatgcc
attatctacctgaaggcactttccgatgaggccaacgagctgttgcccatcttcaataag
acgagctcaaagttctatagggccacggtgcccacaggtgactggtccaatcagagctcg
gacatgaatgcaaggcagctaaatgcgaccatatcgagacgctacagcgacttggaatag

DBGET integrated database retrieval system