KEGG   Drosophila mojavensis: Dmoj_GI21261Help
Entry
Dmoj_GI21261      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00500  Starch and sucrose metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dmoj_GI21261
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dmoj_GI21261
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI21261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM JAB
Motif
Other DBs
NCBI-GeneID: 6580999
NCBI-ProteinID: XP_002006790
FlyBase: FBgn0143991
UniProt: B4KUD8
Position
Unknown
AA seq 690 aa AA seqDB search
MGDPMKVEVKDIDKLLEMDGYLKPFEREIRRRHGVLKDWIAKIDQCEGGLEEFSQGYKYY
GLHFQPDNSVIAREWAPGARDVYLTGDFNNWHWESHPYKKLPFGKWELHLPANPDGSAPI
KHLSEIKVIIRNQHGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWQPPEGERYQRQNAR
PPKPKSLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFYAASSRYGNPEQLKRMIDVAHAQGLYVLLDVVHSHASKNVQDGLNQFDGTNSCF
FHDGARGEHALWDSRLFNYTEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANYMLHKLDPEVITIAEDVSGMPTLCRPVSEGGIG
FDYRLGMAIPDKWIELLKEQTDDQWDIGNIVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTLSEPSIIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDNMLKYKYLNEFDRAMNELEERYGWLHSGPAYVSWKHQS
DKTIHFERAGLVFVFNFHPTQSFSDYRVGTNWAGTYQAVLSSDDPLFGGHNRIDMNCKHQ
SDPWGHAGRSNFIQVYTPCRTAVVYARISD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatccaatgaaagtggaagttaaggacattgacaagctgctcgaaatggatggc
tatctgaagccgttcgagcgtgagattcgtcgccggcatggcgtactgaaggattggatt
gcgaagattgatcaatgcgagggcggcttggaagagttctcgcagggctacaagtactac
ggcctacactttcagccggataattcagtgattgcacgcgagtgggcgccgggtgcaaga
gatgtgtatcttactggcgatttcaacaattggcactgggaatcgcatccgtacaagaag
ctgccctttggcaagtgggagcttcatttgcccgccaatccagatggcagtgcgccaatt
aagcatcttagcgagataaaagtcatcatacgcaaccagcacggtcagctattggatcgc
ctctcgccctgggccaagtatgtggtgcagccgcccaagagcgccaatcagggagtcaac
tacaagcagtatgtgtggcagccgccagaaggagagcgctatcaacgacagaacgcacga
ccgcccaagcccaagtccctgagaatctacgagtgccatgtgggcatagcctcgcaggag
cctcgagtgggcagctacgatgagttcgcggatcgcattgtgccgcgcattaagcgacaa
ggctacaactgcatccaggtgatggccatcatggagcacgcctactacgccagctttggc
taccaggtgaccagtttctatgcggcttccagccgctacggcaacccggagcaactcaag
cgcatgatcgatgtggcccacgcccagggtctctacgtgctacttgatgtggtgcactcg
catgcgtccaagaacgtgcaggatggcctaaatcaattcgatggcaccaacagctgcttc
ttccacgacggcgcacgtggtgagcacgccctttgggatagccgtctgttcaactatacg
gagtacgaagtgctgcgcttcttgctgtccaacttgcgctggtggcacgatgagtacaat
ttcgacggctatcgcttcgatggcgtcacctccatgttataccactcgcgcggcatcggc
gaaggcttcagtggcgactacaacgaatactttggcctcaacgtggacacagatgcactc
aactatctgggtctcgccaactacatgctgcacaagctggaccctgaggtcataaccata
gctgaggacgtttctggcatgccgacactgtgtcgccccgtgtcggagggcggtattgga
tttgactatcgcctgggcatggccattccagacaagtggatcgagctgctgaaggaacaa
accgacgatcagtgggacattggcaacattgtgcacacgctgaccaaccgacgctggatg
gagaacacggtggcctatgccgagtcccacgaccaggcgcttgtcggcgacaagaccatt
gccttctggctgatggacaaggaaatgtacacgcatatgtccacattgtcagagccgtcg
ataatcattgatcgtggactggcactgcataagatgattcgtctcatcacgcatgcattg
ggcggcgaggcatatctcaatttcatgggcaatgagttcgggcatcccgagtggctcgac
tttccgcgcgtgggcaacaatgactcgtaccattatgcgcgtcgccaatggaatttggtg
gatgacaatatgctaaagtacaagtacctaaacgaatttgaccgtgccatgaatgagttg
gaggaacgctatggctggctgcactcgggccccgcctatgtgagctggaaacaccagagc
gacaagacaatccactttgagcgcgcgggtctcgtttttgtgttcaacttccatcccact
cagagcttcagtgattatcgcgtgggcaccaactgggctggcacctatcaagctgtgctt
tcctccgacgatcccctctttggcggccacaatcgcatcgacatgaattgcaagcatcaa
tcggatccctggggccatgccggtcgctccaacttcattcaagtctacacgccttgtcgc
accgccgtcgtttatgccagaatcagcgattag

DBGET integrated database retrieval system