KEGG   Drosophila mojavensis: Dmoj_GI21755Help
Entry
Dmoj_GI21755      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dmo03110]
    Dmoj_GI21755
Enzymes [BR:dmo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Dmoj_GI21755
Chaperones and folding catalysts [BR:dmo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Dmoj_GI21755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 6585191
NCBI-ProteinID: XP_002010827
FlyBase: FBgn0144485
UniProt: B4L5M3
Position
Unknown
AA seq 223 aa AA seqDB search
MVFLGATLLRNIHKSSALRLAGSAILPQKSITPARIASNRGQLQFGIQFVREYSKQSKMS
TLPRVFFDMTADGEPVGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPNFM
CQGGDFTNHNGTGGKSIYGNKFPDENFRLKHTGPGILSMANAGANTNGSQFFICTVKTAW
LDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIVVEDCGAL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtatttttaggtgcaactctgcttcgtaacattcacaagtcgtcggcacttcgctta
gctgggtccgccattttacctcaaaaatctataaccccagctcgaattgccagtaacaga
ggtcagttgcaatttggaattcagtttgttcgcgaatattcgaagcagtccaaaatgagt
actttaccgcgagtattcttcgatatgaccgccgatggcgagcccgtcggtaggatagta
atggagctgcgctctgacgtcgtgccgaagacagcggagaatttccgtgctctgtgcacc
ggcgagaagggctttggctacaagggctccagtttccatcgcgtcattccaaacttcatg
tgccagggcggcgatttcaccaaccacaatggcactggcggcaagtccatctatggcaac
aagttccccgatgagaacttccgcctgaagcacaccggccccggcatcctgtcgatggcg
aacgctggcgccaacaccaacggctcccagttcttcatttgcaccgtgaagaccgcttgg
ctggacaacaagcatgtcgtcttcggcgaggtcgtcgagggccttgacgtcgtcaagaag
atcgagtcttacggctcacagtccggcaagacctcaaagaaaattgtggtcgaggactgt
ggtgcactttaa

DBGET integrated database retrieval system