KEGG   Drosophila mojavensis: Dmoj_GI22072Help
Entry
Dmoj_GI22072      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03254  translation initiation factor 3 subunit A
Organism
dmo  Drosophila mojavensis
Pathway
dmo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dmoj_GI22072
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dmo03012]
    Dmoj_GI22072
Translation factors [BR:dmo03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    Dmoj_GI22072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 6575244
NCBI-ProteinID: XP_002001258
FlyBase: FBgn0144801
UniProt: B4KA44
Position
Unknown
AA seq 1141 aa AA seqDB search
MARYTQRPENALKRANEFIEVGKPLRALDTLQEVFRNKRWNYAYSETVIEPLMFKYLYLC
VELKKSHIAKEGLFQYRNMFQLVNVNSLENVIRGYLKMAEEHTEAAQAQSSAAVAVLELD
DLDNIATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLRVNTHCEALYHD
IARMAFQFCLKYNRKSEFRRLCDKLRKHLEDICKSSNQTTGVSINKVETQQLCLDTRLYL
LDSAIQMELWQEAYKAIEDIHGLMAMSKKTPVPKTMANYYQKLAMVFSKAGNQLFHAAAL
LKLFQLTRELKKNLTKDDLQRMAAHVLLATLSIPLPSAHPEFDRFIEADKSPLEKAQKLA
VLLGLPQPPTRVSLIREVVRLNVPNLVSEDFRNLYNWLEVDFNPLNLCKRIQSIVDTIEA
SETENTLLTPYIQSLKDVTIMRLIRQISQVYESIEFKRLLELAPFCNIFELEKLLVESVR
HNDMQIRIDHQRNSIYFGTDLTESQREYRPDGPTLQSMPSEQIRSQLVNMSTVLTRAVSI
VYPNRERDQRAKLRSQMVQHYHEIKDREHQRILQRQKIIEDRKEFIEKQNNAREEEEARR
HEEESRKAKLAEQKRLEQEQEERERKRHENEIQAIKEKSLKEKVQQISQTAHGKKMLSKL
DEEGIKKLDAEQIAMRESEELQRERKELQSKLKSQEKKIDYFERAKRLEEIPLFEKYLAE
KNVKDKEFWEATEATRIENAIAERKDAVSQQERLKRMYPDRDEFLEALKKERASLFVEKL
KKFEIALAEERKKRLAERVVRRREERRQAYLRAKEEERFRKEEEIRLAREAEERAAAEAR
RLEREAEDEKRRQQYEKQRAKEEEAERKIQEDRERLAREVAVERERSEKERDVWRPRGDR
SERPSAAPAGGASEWRRNAPTSDRNDRNDRNERNDRSDRNDRNDRSERIERSDRNDRPER
KDTDGGADSSWRVRREPVEPQRGPGTASTGMDRSERGGGAGGGPSGRDDKWRRGGDRSER
LGGDRDRDRDRDSFRRNDGPRRDDDRGGFRRDDQPQRDTGSNWRDSPRQNDRDNRDNRRP
AGDRRDIRGAGPKEGGGGGGGGNWRTAPSPRDEKPPVKRDQPQDKENKAGDDGEWTSVKR
R
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttacactcaacgtccggaaaatgctcttaaacgagccaatgaatttatcgag
gtcggaaaacctttgcgtgccctggatacgttgcaggaggttttccgcaacaagaggtgg
aactatgcctactccgagacggtcattgagcctctcatgttcaagtacttgtacttgtgc
gtggagctcaagaagtcgcatattgccaaggagggtctcttccaatatcgtaacatgttc
caattggtgaatgtgaactcactggagaatgtaatacgcggctacttgaaaatggccgag
gagcataccgaggcggcccaagcgcaatcatcggccgccgtggctgtgctggaactggat
gatcttgataatattgcgacaccagagagcattttgatgagtgccgtttgcggagaggat
gcccaggatcgttcggatcgtactattttgttgccatgggttaaattcctttgggaatcc
tattgccagtgtcttgagctgttgcgcgtcaacactcattgcgaggcgctttatcacgat
attgcgcgcatggcctttcagttctgcttgaagtacaatcgcaagagtgaattccgtcgc
ttgtgcgacaagctgcgtaagcatcttgaagacatctgcaagagcagcaatcaaacaaca
ggcgtgtctatcaacaaggtcgagacacaacagttgtgcttggataccaggctctacctg
ttagactcggccatacaaatggagctgtggcaagaagcctacaaggcaatcgaggacatt
cacggtctgatggccatgtccaagaagacgccggtgccaaaaaccatggctaattattat
cagaaattggctatggtcttcagcaaggctggcaatcagctcttccatgcagccgctttg
ctcaagctgttccagttgactcgcgagctcaagaagaatcttactaaggatgatctgcag
cgtatggcagctcatgtacttctggctacgctgtcgatacctctgccttctgctcatccg
gaattcgatcggttcatcgaggcggacaagagtcctctggagaaggcccaaaagctggcc
gtgctgctgggtctgccccagccgccgacgcgtgtctctctaatccgggaagttgtgcgc
ttgaatgtgccgaatctggtatccgaagacttccgtaacctatacaactggctcgaggtg
gactttaatccactcaatctctgcaagcgtattcagtctattgtggataccattgaagcc
agtgaaacggagaatactctgctcacaccttacatccaatcattgaaggatgtgactata
atgcgtctaattcgccaaatctctcaagtctatgagagcatcgagtttaaacgtttgctg
gaactggcgccgttctgcaatatttttgagctggagaagctgttggtggagtcagtgcgt
cacaatgacatgcaaatacgcatcgatcatcagcgcaacagcatttacttcggcactgat
ctaactgagagtcagcgcgaatatcgtcctgacggaccgacactgcagtcaatgccctcg
gagcagattcgttcccagttagtcaacatgtccaccgtgttaactcgagccgtttctatt
gtatatccgaatcgggagcgtgatcaaagggctaagctgcgcagccaaatggtacagcat
tatcatgagatcaaagatcgtgaacatcagcgcattctgcaacgccagaagatcattgaa
gatcgtaaggagttcattgagaagcagaataatgcgcgcgaggaggaggaagctcggcgc
cacgaagaggaatcacgcaaagccaagttggccgagcagaagcgattggagcaggaacag
gaggagcgggagcgcaagcgtcatgagaacgaaatccaggcgatcaaggagaagagcctt
aaggagaaggtgcagcaaatatcgcagactgcgcacggcaagaaaatgctttccaaattg
gatgaggaaggcatcaagaaactcgatgctgagcaaattgctatgcgtgaaagcgaagag
ctgcagcgagagcgcaaggagctgcagtccaaactcaagtcacaagagaagaagattgac
tactttgagcgtgccaagcgtctggaggagattccactctttgagaaatatctggctgag
aagaatgtcaaggacaaagagttttgggaagccaccgaagccactcgcattgaaaacgca
attgccgaacgcaaggatgccgttagccagcaggagcgtcttaagcgtatgtatcccgat
cgcgatgagtttctcgaagcacttaagaaagagcgtgcctcgctcttcgttgagaaactc
aagaagttcgaaattgctcttgccgaggagcgtaagaagcgtctcgctgagcgtgtggta
cgccgtcgcgaggaacgccgccaagcctacctgcgtgccaaggaagaggaacgtttccgc
aaggaggaagagatacgtcttgctcgcgaggccgaagagcgagccgctgccgaggctcgt
cgtctggaacgtgaggcagaggatgagaagcgtcgtcagcaatatgaaaagcaacgtgcc
aaggaggaggaggccgaacgtaagatccaggaggatcgcgaacgtcttgcccgcgaggtg
gctgtcgagcgtgaacgcagcgaaaaggagcgcgatgtctggcgtccacgcggtgatcgc
agcgaacgaccaagtgctgctccagctggcggtgccagcgagtggcgtcgtaatgctcct
acaagtgatcgcaatgaccgtaacgatcgcaatgaacgtaacgatcgtagcgatcgcaat
gaccgtaatgatcgtagcgaacgcattgagcgtagcgatcgcaatgatcgcccagaacgc
aaggacactgatggcggtgctgattcgtcatggcgtgtgcgccgtgaacctgtcgaacca
cagcgtggtcctggtactgctagcactggtatggatcgttcagaacgtggtggcggcgct
ggcggtggtccgtctggtcgcgatgacaagtggcgtcgtggtggtgatcgctccgagcgt
cttgggggtgatcgtgatcgcgatcgcgatcgtgactccttccgccgtaatgatggacca
cgccgtgatgatgatcgcggtggcttccgtcgtgacgatcagccccagcgtgatacaggc
agcaactggcgcgattcgccacgtcaaaacgatcgcgataatcgagataatcgccgtccg
gctggcgatagacgcgatattcgtggcgctggaccaaaggaaggaggcggcggtggcggt
ggtggtaactggcgtacggctccctctccacgcgatgaaaaacctccagtcaagcgcgat
cagccacaagacaaggaaaacaaagccggagatgatggcgaatggacaagcgttaagcgt
cgttaa

DBGET integrated database retrieval system