KEGG   Drosophila mojavensis: Dmoj_GI22182
Entry
Dmoj_GI22182      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
dmo  Drosophila mojavensis
Pathway
dmo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmoj_GI22182
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI22182
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dmo04812]
    Dmoj_GI22182
Membrane trafficking [BR:dmo04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    Dmoj_GI22182
Cytoskeleton proteins [BR:dmo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     Dmoj_GI22182
SSDB
Motif
Pfam: P34-Arc ARPC4
Other DBs
NCBI-GeneID: 6577546
NCBI-ProteinID: XP_002003511
FlyBase: FBgn0144911
UniProt: B4KEQ3
Position
Unknown
AA seq 301 aa
MILLEINNRIIEETLLVKYRNALAGLKPESIDILIADFDSVLYHISNVNGDKTKVRISIS
LKFYKQLQEHGADELLKREYGSLLTETEKGYNVSVLINLEDIPSDWEQIAKRIGLLKRNC
FASVFEKYFDFQEQGEETQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKV
FMQELREGRRASHTAPQVLFSHREPPLELANSDARVGDNIGYVTFVLFPRHTNKETRDNT
INLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPESKSTEKKTITGRTFIRK
E
NT seq 906 nt   +upstreamnt  +downstreamnt
atgatattgctggaaatcaataatcgcatcatcgaggaaacgctcctggttaaataccgc
aatgcactggctggactcaaaccagaatcgatagatatattaatcgcagatttcgacagt
gtattatatcatatttccaatgtgaatggtgataaaacaaaagtgcggataagcatttcg
cttaagttctacaaacagctgcaggaacatggagccgatgagttgctgaagcgagaatac
ggaagtctgttaactgagacagaaaaaggttacaatgtttctgtacttattaatcttgag
gatataccctcggactgggagcagattgcaaagagaattggactgctaaaacgcaattgt
ttcgcctctgtgttcgagaaatattttgacttccaggaacagggcgaagagacccaaaag
cgagcagtcattaactaccgcaacgatgagacactttatgtggaggcaaagcctgatcgt
gtcaccgtagtgttcagcaccatttttagggacgaggacgatgtaatcattggcaaggta
tttatgcaggaattgagggaaggacgacgtgcatcgcatacagcgccacaagtgctcttc
tcgcatcgtgaaccacctttggaactggctaatagcgatgcccgggtgggcgataacatt
ggatatgttacattcgtgctattccctcgacataccaacaaggagacccgggataatact
ataaatttaatacacatgttccgagactatttgcattatcacattaagtgttcaaaggcg
tatattcattcccgcatgcgcgcaaaaacttcagacttcctcaaggtgctaaaccgtgca
aggcccgaatcgaagagtacggaaaagaagactatcacggggagaacattcatacgcaaa
gaatga

DBGET integrated database retrieval system