KEGG   Drosophila mojavensis: Dmoj_GI22905
Entry
Dmoj_GI22905      CDS       T01062                                 
Name
(GenBank) uncharacterized protein
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00240  Pyrimidine metabolism
dmo00983  Drug metabolism - other enzymes
dmo01100  Metabolic pathways
dmo01232  Nucleotide metabolism
dmo01240  Biosynthesis of cofactors
Module
dmo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dmoj_GI22905
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dmoj_GI22905
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     Dmoj_GI22905
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin Zeta_toxin AAA_33 AAA AAA_19 NTPase_1 Ploopntkinase3
Other DBs
NCBI-ProteinID: EDW15210
FlyBase: FBgn0145632
UniProt: B4K6D7
AA seq 256 aa
MWRAITRIPKTLDSLGQGVAVLPQQFQHSQLYNNNHNICSKTNYLSLHNQASLIRPKYRM
SSAKPKVVFVLGGPGAGKGTQCSKIVERFQFEHLSAGDLLREERSREGSEYGQLIEEYIR
NGKIVPVEVTCSLLENAMKNSGKSRFLIDGFPRNQDNLDGWNRQMSDKTEMQFVLFFDCA
EDVCVKRCLGRGQSGSGRSDDNMESLKKRIQTYNNDSLPIIKYFENAGQVKRIDASPDAD
KVFQEVERVFLANGFQ
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtggcgcgcaattacgcggataccaaaaacacttgactctcttggccaaggtgtcgca
gtgctacctcagcagttccaacattcccagctgtacaacaacaaccacaatatctgcagt
aaaaccaattacctcagcttacacaaccaagcgtcgctcataagacccaaatacagaatg
tcgagtgcgaagccaaaggttgtctttgttttaggaggccccggtgcgggcaaaggcacg
cagtgctcgaaaattgtcgaacgatttcaattcgaacacttatcggctggcgatttgttg
cgtgaggagcgctcacgcgagggctctgaatatggccagcttatcgaggagtacatacgc
aatggcaagatagttcccgtagaggtcacatgctcgctgctggaaaatgcgatgaaaaac
tcgggcaagtcacggtttcttatcgatggattcccccgcaaccaggacaatttggatggc
tggaaccgccagatgtccgacaagacagaaatgcagtttgtgctgttcttcgattgcgcc
gaagatgtgtgcgtgaagcgctgcttaggacgcggccagagcggctccggccgcagcgac
gacaacatggaaagcctgaaaaagcgtatccaaacctacaacaacgactcgttgcccatc
atcaaatactttgagaatgcagggcaggtcaagagaattgacgctagccccgatgcggac
aaagtctttcaggaggtggagcgcgtgttcttagccaatggtttccaatga

DBGET integrated database retrieval system