KEGG   Drosophila mojavensis: Dmoj_GI23305Help
Entry
Dmoj_GI23305      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04013  MAPK signaling pathway - fly
dmo04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI23305
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI23305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dmo01009]
    Dmoj_GI23305
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmoj_GI23305
    3.1.3.48  protein-tyrosine-phosphatase
     Dmoj_GI23305
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    Dmoj_GI23305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT JAKMIP_CC3
Motif
Other DBs
NCBI-GeneID: 6572918
NCBI-ProteinID: XP_001999021
FlyBase: FBgn0146032
UniProt: B4K969
Position
Unknown
AA seq 455 aa AA seqDB search
MRIKREAPCLLLFMPLPNNNNNNNNRIGANHKDYPNNKRSRENLACDEQQLTATSTTAAM
NAGSNGGRTPPLMRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTC
QSPSESHLQGLKYMQIPASDTPHQNIKQYFQEAFDFIEDARKTGSRVLLHCHAGISRSAT
IAIAYVMRYKSLSLIEAYKLVKVARPIISPNLNFMGQLLELEQSLLKSGALAPLPTVSPS
ASPAASSHASASSQLVEEPEEEEEAELRPMPVPRKSKSDSEAMDEDVYDYDDVDSGASSF
AGSNCSSRLTSPPVTPDETPCTSAAAAASAAAVTELDSPCSNSSSGIYSISTSQEFTPAA
PAPVTPAATSTTATLSPTRPLALFKRNSPVKLRLNLEPSYNTPNIPKSISCISIHNASQH
SPLPREAPATPSCELAPTMPNGDNNNNLVAATSSD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcggataaagagagaagcgccgtgtctactgttatttatgccattaccaaacaataac
aacaacaacaacaatcgcattggcgctaatcacaaggactatcccaacaacaagcgttcc
agggaaaatctggcatgtgacgaacaacagctgacggcgacgtcaacgacggcagcaatg
aacgctggcagcaatggcggccgaacgccgccgctcatgcgcagctgttccagtccggcg
gtttacgatatcgaaacacatcccgcttcgccagtattcccacatctgctgctgggcaat
ggccgggatgcggacgatcccagcagcgtgggcgccaattgtgtgttgaatgttacctgc
caaagtcccagcgagagtcatctgcagggtctgaagtatatgcaaatacctgccagcgat
acgccccatcaaaatattaaacaatattttcaggaggcattcgatttcatagaggatgca
cgcaaaacaggttcgcgcgttttgctacactgtcacgcgggcatctcgcgcagcgccacc
atcgccattgcgtacgtcatgcggtacaagtcgctgtcgctgatcgaggcctacaagcta
gtgaaagtggcccggcccatcatctcgcccaatctgaacttcatgggccagttgctcgag
ctggagcagagtctgctcaagagcggcgccctggcgccgctgcccactgtgtccccatcc
gcatcgcccgctgccagcagccatgcgtcagcatctagtcagctcgtggaagagcccgag
gaggaggaggaggccgagttacgtccgatgccagtgccgcgcaagtccaagtcggacagc
gaggccatggacgaggatgtctatgattatgatgatgtggacagtggcgccagcagcttt
gccggcagcaattgctcatcgcgcctcacctctccgcccgtcacaccggacgagacgccc
tgcacgtcggcagcggcggcggcgtcagcagcagctgtaactgaactggactcgccgtgc
tccaatagcagcagcggcatctactccatttcaacatcgcaagagtttacacctgctgcg
cccgcacctgttacacctgctgcaacgtcgacgacggcgacactgtcgcccacgcgaccg
ctggcgctcttcaagcgcaattcgccggtgaagctgcggctcaatctggagcccagctat
aacacgcccaacataccaaaatccatatcctgcatatccatacacaatgccagccagcat
agtccgctgccgcgggaggcgccagccacgcccagctgcgagctggcgcccacaatgccc
aatggcgacaacaacaacaacttggtggcggccacgtcgagtgattga

DBGET integrated database retrieval system