KEGG   Drosophila mojavensis: Dmoj_GI24144Help
Entry
Dmoj_GI24144      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dmo03019]
    Dmoj_GI24144
Enzymes [BR:dmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     Dmoj_GI24144
Messenger RNA biogenesis [BR:dmo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     Dmoj_GI24144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 6572654
NCBI-ProteinID: XP_001998760
FlyBase: FBgn0146867
UniProt: B4K797
Position
Unknown
AA seq 617 aa AA seqDB search
MADAWDIKSLKTKRNTLREKLEKRKKERIDILSDKQEDQSNPKKELVEADVDVQKAVLQT
LSASTLVLPIVSTQVVDKVGCLIEKPPTMEMVNFILGKLANQGAIGIRHVTIGTEAGYEV
ISVQTKELLEIYDDINDSCQQNEETDAKRKLESGQDEENDDDQLQRKIQKMDSGSARKES
TSLDASDDIMMLLSLPSTREKQSKQVGEEILELLTKPTAKERSVAEKFKSHGGAQVMEFC
SHGTKIECLKAQQVANEMAAKKKLERREEKELRNAVAADGAIANSSKLVKLSSEDAEDGE
IIAENLNNCEADSQESTDDSESSGDSDKCTKLHFKKIIQSHTDESLGDCSFLNTCFHMAT
CKYVHYEVDTLPHINTNKPTDVKTKLSMKRSIDSSCTLYPPQWIQCDLRFLDMTVLGKFA
VVMADPPWDIHMELPYGTMSDDEMRALGIPALQEEGLIFLWVTGRAMELGRDCLKLWGYE
RVDELIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPTNLNRGLDCDVIVAEVRAT
SHKPDEIYGIIERLSPGTRKIELFGRPHNIQPNWITLGNQLDGIRLVDPELITQFQKRYP
DGNCMSPTAAAVNAIKN
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgcatgggacataaagtcacttaagacaaagcgcaatactctgcgcgagaag
ctggaaaagcgtaaaaaggaacggatcgatatactttctgacaaacaagaggaccagtcc
aacccaaaaaaagagcttgttgaagccgatgtggacgtacagaaggctgtacttcagaca
ctcagtgctagcactctcgtccttcccattgtctcaacgcaagtggtcgataaagtcggc
tgcctaatagagaagcctccaacgatggaaatggtcaactttatacttgggaagctagcc
aatcagggcgcaattggtataaggcatgtcacaattggcacagaagcgggatacgaagtg
atatctgtacaaaccaaggagctattggaaatatacgacgatattaacgacagttgccag
cagaatgaggaaactgatgcgaagcgaaaattagaatctgggcaggatgaggagaacgat
gatgaccagttacagcgtaaaatacaaaaaatggattcaggaagcgcacgcaaagagtca
accagtctggatgcatcggatgacatcatgatgctgttgtccctgccttcaacacgagag
aagcaaagcaaacaggtcggcgaggagatactcgaattgctgaccaaaccgacggccaag
gaacgctccgtggccgaaaagttcaaatcccacggaggtgcacaagtcatggagttctgc
tcccatggaaccaaaatcgagtgcctcaaggctcagcaggtagccaatgaaatggcagca
aaaaagaaactcgagcgtcgcgaggagaaagagcttcgcaatgctgtcgctgccgatgga
gccattgccaatagcagcaagctagtcaagctgagttccgaggatgccgaagatggcgag
atcatagcggagaacctaaacaactgtgaggccgactcgcaggagtccacagatgatagc
gaatcctccggtgactcggacaaatgcacaaaactgcactttaagaaaatcattcaatcc
cacacggacgagtcgctgggcgattgcagtttcttgaacacctgcttccacatggccact
tgcaagtacgtgcactacgaggtggatacgctgccacatatcaacacgaataagccgacg
gatgtgaagactaagctcagcatgaaacgaagcatcgactccagttgcactctctatccg
ccgcagtggattcagtgtgatcttcgatttctggacatgacggtgctcggtaaattcgct
gtcgtcatggccgatcccccatgggacatacatatggagctgccgtatggcaccatgtcg
gacgacgagatgcgcgcactaggcataccagcactgcaggaagaaggcctgatattccta
tgggtaacggggcgtgccatggaactgggacgtgattgcctgaagctctggggctatgag
cgtgtcgatgagctgatctgggtgaaaacgaatcagctgcagcgcatcatacgcactggc
cgcaccggtcactggctgaatcacggcaaggagcactgcctggtcggcatgaagggcaat
ccgacaaatctgaatcgcggcctcgactgtgatgtcatcgtcgcagaggtgcgcgctacc
agtcacaagcccgacgagatctatggcatcattgagcgcctcagtccgggcacccgaaaa
atcgagctcttcggccgaccgcacaacattcagccaaactggataacgctgggcaatcaa
ttggatggcattcgcctagtcgaccccgagctaattacccaattccagaagcgttatccc
gatggcaactgcatgtcgcccacggcggcggcagtgaacgcgattaagaactaa

DBGET integrated database retrieval system