KEGG   Drosophila mojavensis: Dmoj_GI24163Help
Entry
Dmoj_GI24163      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dmo  Drosophila mojavensis
Pathway
dmo03040  Spliceosome
dmo04141  Protein processing in endoplasmic reticulum
dmo04144  Endocytosis
dmo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dmoj_GI24163
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmoj_GI24163
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmoj_GI24163
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmoj_GI24163
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dmo01009]
    Dmoj_GI24163
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dmo03041]
    Dmoj_GI24163
   03009 Ribosome biogenesis [BR:dmo03009]
    Dmoj_GI24163
   03110 Chaperones and folding catalysts [BR:dmo03110]
    Dmoj_GI24163
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI24163
   03051 Proteasome [BR:dmo03051]
    Dmoj_GI24163
   03029 Mitochondrial biogenesis [BR:dmo03029]
    Dmoj_GI24163
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmo04147]
    Dmoj_GI24163
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dmoj_GI24163
Spliceosome [BR:dmo03041]
 Complex B
  Other components
   Prp19 complex
    Dmoj_GI24163
 Complex C
   Prp19-CDC5 complex
    Dmoj_GI24163
Ribosome biogenesis [BR:dmo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dmoj_GI24163
Chaperones and folding catalysts [BR:dmo03110]
 Heat shock proteins
  HSP70 / DNAK
   Dmoj_GI24163
Membrane trafficking [BR:dmo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dmoj_GI24163
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dmoj_GI24163
Proteasome [BR:dmo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dmoj_GI24163
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dmoj_GI24163
Exosome [BR:dmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmoj_GI24163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A DUF1843
Motif
Other DBs
NCBI-GeneID: 6572686
NCBI-ProteinID: XP_001998792
FlyBase: FBgn0146886
UniProt: B4K7C9
Position
Unknown
AA seq 640 aa AA seqDB search
MPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP
SNTVFDAKRLIGRKYDDPKIQSDMKHWPFKVVNDCGKPKINVEFKGEQKRFAPEEISSMV
LVKMKETAEAYLGTTIRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLA
DEFKRKFKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEIDALFEGHDFYTKVSRARF
EELCGDLFRGTLQPVEKALNDAKMDKSQIHDIVLVGGSTRIPKVQSLLQNFFSGKSLNLS
INPDEAVAYGAAIQAAILSGDQSSQIKDVLLVDVAPLSLGIETAGGVMTKLIERNSRIPC
KQSKTFTTYADNQPAVTIQVFEGERAMTKDNNVLGTFNLTGIPPAPRGVPKVEVTFDLDA
NGILNVTAKEMSTGNAKNITIKNDKGRLSQADIDRMVSEAEQYAEEDEKHRQRIAARNQL
ESYIFGVKEAAENAKDKISQSERSTVLDKCSEAIKWLDANTTAEKEEYEYKLQELTKVCS
PVMTKMHQSAGGGDGPQASHCGQQARGCNGSGGPTIEEVD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaattggtattgacttgggaaccacctactcctgtgttggtgttttccagcac
ggcaaggtggagataatagccaacgaccagggcaaccgcaccacgcccagctacgtggca
tttactgactcggagaggttgattggagacgcggccaagaaccaagtggccatgaatcca
agtaacactgtcttcgatgcgaagcgtttgattggacgtaaatatgatgatccgaagatt
cagagcgacatgaagcactggccattcaaagtggtcaacgactgcggcaaaccaaagata
aatgtcgagttcaaaggcgaacagaagcgctttgcgccggaggagatcagttcgatggtt
ctggtaaagatgaaggagacggccgaagcttacttgggcaccaccatcagagacgccgtc
atcactgtgcctgcctacttcaatgactcgcagcgtcaagcaaccaaagacgccggtgcc
atcgccgggctgaacgtgctgcgcatcatcaatgagcccactgcagcagctctggcctat
ggcttggacaagaatctcaaaggcgaacgcaatgttctaatattcgacttgggtggcggc
accttcgatgtgtcaattctgaccatcgacgagggctctctgtttgaagtgagagccact
gctggagatactcatctgggcggagaggacttcgacaacagactagtcaatcatttggca
gatgagtttaagcgcaagtttaaaaaggatctgcgctccaatccacgagcactgcgtcgg
ctgcggactgcagctgagagggcaaagcgcacattgtcgtcaagcaccgaagctaccatc
gagatcgacgcgttgtttgagggccatgacttctacacaaaggttagccgagcgcgcttc
gaggagttgtgcggcgatctgttccgcggcacactgcagcctgtggagaaggctctgaat
gatgccaagatggacaagagccagattcacgacatcgtcttggttggcggctcaacacgt
attccgaaggtgcagagcctgctgcagaacttcttctcaggaaagagcctcaacctgtct
atcaatccggacgaggcggtggcctacggagccgccattcaagctgccattcttagtgga
gaccagagcagccagatcaaggacgtgctgctggtcgatgtcgcgccgctctcactgggc
atagagacagctggtggagtaatgacgaaactgattgagcgcaacagccgcattccttgc
aagcagtcgaagaccttcaccacatacgcggacaaccagcccgccgtgacaattcaggtg
tttgagggcgagcgcgccatgacaaaggacaacaacgtgctgggcactttcaatctgacc
ggcattccaccagctccgcgcggtgtgccaaaggtggaagttaccttcgatttggacgcc
aacggcatactcaatgtgacagccaaggagatgagcactggcaatgccaagaacataacc
atcaagaacgacaagggacgtctctcgcaagccgacatcgatcgcatggtgagcgaggcc
gagcagtatgccgaggaggacgagaagcatcgccagaggattgctgctcgcaaccagctg
gagagctacatctttggcgtgaaggaggctgccgagaacgctaaagacaagatttcgcag
tcggagcgaagcaccgtgctggacaagtgcagcgaagccatcaagtggctcgatgctaat
accacagccgagaaggaggagtatgaatacaaactgcaggaactcacaaaagtctgcagt
cctgtgatgacgaagatgcatcagtcagctggaggcggcgatggtcctcaagcgtcccac
tgtggtcaacaagctagaggctgcaatggtagcggtggccccactattgaggaggttgat
tag

DBGET integrated database retrieval system