KEGG   Drosophila mojavensis: Dmoj_GI24676Help
Entry
Dmoj_GI24676      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K14388  solute carrier family 5 (sodium-coupled monocarboxylate transporter), member 8/12
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dmo02000]
    Dmoj_GI24676
Transporters [BR:dmo02000]
 Solute Carrier Family (SLC)
  SLC5: Sodium glucose cotransporter
   Dmoj_GI24676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF SSP160 DUF5325
Motif
Other DBs
NCBI-GeneID: 6573656
NCBI-ProteinID: XP_001999722
FlyBase: FBgn0147398
UniProt: B4K6B0
Position
Unknown
AA seq 703 aa AA seqDB search
MSTTIQREEIIMDAVEAVNTPPTVVNAIVQTVQSIISSTTAKATTSVSGLGSSSISTVAA
ITTTSGTTDTTEGTIPTTFSTTTTTTTISSSSLTEKPSVSDLSSALQHFGIVDYLVFIAM
LVVCAVIGFYFGFIEKKKKLEKGQLPTDEKDGAGTAGIEERRGSEALDYLVGGRKMKVLP
VSLSLVASFVSGISLLGTSTEIYVYGTQYAFILVTLAISGMISWYIFLPVFCNLQLTSTY
EYFKLRYGSSIRNFGAVLFVIGMLLWQPVALYVPAITYNQVTGTSIHVITPIVCIICTFY
TCVGGLKAVIWTDVIQSFVMYGSILAVCIKGTYDVGGLGVVLQRNEDSGRFNAPEWTWDP
TVRLSMVSVIVGGTLHKIQSSDVNQVSIQRFLSLPSYKHAKQCMFLYTVLLIFLLSCCSY
MGLVTYAVYQDCDPISTGLAKASDQLPSLLMMRTLGSFPGLPGLFVAGVFSAALSSLSTG
LNSMACVISQDVVRPLLKKPLTERQTALLLRAIVVFFGLSCMGLVNVVEKLGMVLQLATT
TSAVSMGPLLGIYAMGVCLPWVNAKSVMTGSLVSFVVLGWICVKAQLAQMQGEIRYPKMP
VSVSGCDYAFDNATVWRTLHEYSPSTDRNIYHLSFFWYTALGGLICTVVALLASLVFGWQ
DVSEMDPALVTPCMRRFLPKKQYEAVDLEELFRRKADPTAEKP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaccattcagagggaggaaataataatggatgcggttgaggctgttaatacg
ccgccgacagtggtcaatgcgattgttcagacagtccaatccataattagcagcacaacg
gcaaaagcaacaaccagtgtatcaggcttgggcagctctagcatcagcaccgtcgctgcc
atcaccaccaccagcggcaccactgacaccacagaaggaacaataccaacaacattttca
acaacaacaacaacaacaacaatatcgtcttccagcttgacggagaagcccagcgtgagc
gatttaagcagcgcactgcaacattttggcattgttgattatttggttttcatagccatg
ctggtggtctgtgccgtaattggcttctactttggcttcatcgagaaaaagaagaaactg
gaaaagggccaactgcccaccgatgaaaaagatggcgccggcaccgccggcatcgaggag
cgtcgcggctcggaggccttggattacttggtgggtggacgcaaaatgaaagtgcttccg
gtttcgctatccctggtcgctagtttcgtttcgggcatatcattgctgggaacatcaact
gagatttatgtgtatggtactcaatatgcgttcatattggttaccctggccatatctgga
atgatttcgtggtatattttcctgcccgttttctgcaatcttcaattgacttccacatac
gagtactttaagctgcgctacggtagcagcattcgaaacttcggagctgtgctattcgtc
attggcatgttgctgtggcagcctgtggccctgtatgtgcctgccattacctacaaccaa
gtgactggcacgagcatccacgtcatcacgcccattgtttgcattatttgcactttctac
acgtgtgtgggcggcctcaaggcggtgatttggacagatgtcatccagagctttgtcatg
tacggatccattctggcagtgtgcatcaaaggcacctacgatgtgggcggcctgggcgtg
gtcttgcagcgaaatgaggacagcggacgtttcaatgcgccagaatggacctgggatccc
accgtgcggctgtctatggtctctgtgatagtgggcggcactctgcacaaaatacaatca
tcggatgtcaatcaagtgtcaatccaacgctttctctccctgcccagctacaagcatgcc
aagcagtgcatgttcctctatacggtcctcctcatattcctgctcagctgctgcagctac
atgggcttggtcacctatgccgtctaccaggattgtgatcccattagcaccgggcttgcc
aaggccagcgatcagttgccttcgctgctgatgatgcgcaccttgggctcgtttcctggt
ctgcctgggctgtttgtggctggcgtgtttagcgccgcgttaagttcgctgtccacggga
ctcaactcgatggcatgcgtgatctcacaggatgtggtgcgtccgttgctcaagaagccg
ttgacggaacgccaaaccgctttgctgctgcgcgccatcgtggtcttctttggcctaagc
tgcatgggtctggttaatgtggtggagaagctgggcatggtgctgcagctggccaccacc
acctcggctgtgtccatggggccgctgctggggatctatgccatgggcgtgtgcctgccc
tgggtgaatgctaaaagtgtcatgaccggcagtctggtgtcctttgtagtcctgggctgg
atctgcgtcaaggctcagctggcgcaaatgcagggcgagatccgatatccaaagatgcca
gtctcagtctcgggctgtgattacgcctttgacaatgcgaccgtctggcgcactctgcat
gagtacagtccctcaacagatcgtaacatatatcatctgtcgttcttctggtacactgca
ctgggcggacttatttgcactgtggtcgccctgctggcgagcctcgtcttcggctggcag
gatgtgtctgaaatggacccggccctggtcacgccttgcatgcgtcgcttcctgcccaag
aaacaatatgaggctgtggatctcgaggagctctttaggcgcaaggctgatcctactgca
gagaagccttga

DBGET integrated database retrieval system