KEGG   Drosophila mojavensis: Dmoj_GI26120Help
Entry
Dmoj_GI26120      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
dmo  Drosophila mojavensis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmo04131]
    Dmoj_GI26120
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dmoj_GI26120
Membrane trafficking [BR:dmo04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    Dmoj_GI26120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 26527761
NCBI-ProteinID: XP_015021089
FlyBase: FBgn0280857
UniProt: A0A0Q9X5C7
Position
Unknown
AA seq 265 aa AA seqDB search
MVFVRDPCGIICLIATYGAVIYADYVVICWIIPATMPLSIGVLHVVLFNTVVFLLGMSHS
KAAFSDPGFVSLPAKRLDFSDSHSGNGRGTEWTLCTLCEIYRPPQAHHCTICQRCIRRMD
HHCPCINNCVGECNQKYFLQFLFYVGILCLYSVALVLVSWIFPCTECSLSLIETQLMHTI
VLMMESTLFGLFVTLIMLDQLNVILYDESVFETREQKGAYWSKSRRYQMLAKVFGPGHPM
LWLLPRASLNDATRNHGAALLSHEV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttttcgtacgtgatccctgtggcattatctgcctgattgctacctatggcgccgtt
atctatgcagattacgtggtaatttgctggataataccggcaacaatgccactaagtatt
ggggtcttacatgttgtgctcttcaatacggttgtcttcctgctaggcatgtcgcattcg
aaagcagctttctcagatccgggctttgtatcgctgcccgccaagcggcttgacttctcc
gattcacactctggcaatggccgtggtactgaatggactttgtgcacgctctgcgagatt
tataggccaccacaggcccatcattgtacgatatgccagcgatgcatacgccgcatggat
catcattgtccgtgcattaacaattgtgtgggcgagtgcaatcagaagtactttctacag
tttctcttctatgtgggcattctctgtctctactccgtggcgctggtactcgtctcttgg
atatttccgtgcacggaatgcagtctgagtttaattgagacccaattgatgcataccata
gttttgatgatggaatcgactttgtttggtctgtttgtgaccctcataatgctggatcag
ctgaacgtcatattgtacgatgagtcggtgttcgagacgagagagcaaaagggtgcatat
tggtcaaaaagtcgtagatatcaaatgttggcgaaagtatttggcccagggcatccgatg
ctttggcttctgccccgcgctagcctaaatgacgccacacgcaatcacggcgcggcgctg
ctcagccacgaagtgtag

DBGET integrated database retrieval system