KEGG   Deinococcus maricopensis: Deima_1809Help
Entry
Deima_1809        CDS       T01412                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
dmr  Deinococcus maricopensis
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Deima_1809
Enzymes [BR:dmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Deima_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 MTS Ubie_methyltran Methyltransf_4 PCMT Methyltransf_5 Methyltransf_2 Methyltransf_33 Methyltransf_32 Methyltransf_24 FtsJ DUF938 NodS Methyltransf_9 DREV CMAS
Motif
Other DBs
NCBI-ProteinID: ADV67457
UniProt: E8U8R8
Position
complement(1947409..1948182)
Genome map
AA seq 257 aa AA seqDB search
MAWNPDQYHRFRDARDAPARDLLQLLPEAPYRAIIDLGCGTGDHTATLAQQHPDAQVTGL
DSSAEMLERARTHHQPNLHFTLGAIQALHGTYDLIFSNAALQWLPDHAALLAGLWTHLRP
GGTLAVQVPSNHSHDSHRLLGETADDFREALGGFTRFGPVQGASPVLTPARYAELLDTLG
AANVTALEKVYPVVLPGAEGVLDWVRGTALVPYLSRLDEATGAAFLEAYRARLRARWPGD
RVYYAFTRVLFVAQKPA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaaccctgaccagtaccaccgcttccgcgacgcccgcgacgcgcccgcccgc
gacctccttcagctgctccccgaggcgccgtaccgcgccatcatcgatctgggctgcggc
accggcgatcacaccgccaccctcgcccagcaacacccggacgcgcaggtcaccggcctc
gacagcagcgccgaaatgctcgaacgcgcccggacgcaccaccagcccaacctccacttc
accctcggtgcgattcaggccctgcacggcacctacgacctgatcttctcgaacgcggcc
cttcagtggcttccggaccacgctgcactcctcgcgggtctctggacgcaccttcggccg
ggcgggacgctcgccgtgcaggtccccagcaaccacagccacgacagccaccgcctcctg
ggcgaaaccgccgacgacttccgcgaggccctgggcggtttcacgcgcttcggcccggtt
cagggtgcgtccccggtcctcacgcctgcacgctacgcggagctgctcgacacgctgggc
gccgcgaacgtcaccgcgctggagaaggtgtacccggtcgtgctgcccggcgcggaaggc
gtgctcgactgggtgcgcggcaccgccctcgtcccgtacctctcgcggctggacgaagcg
accggcgcggcgttcctcgaggcgtaccgcgctcggctgcgggcccgctggcccggcgac
cgggtgtactacgccttcacgcgggtgctgttcgtggcgcagaagcctgcttga

DBGET integrated database retrieval system