KEGG   Deinococcus maricopensis: Deima_2644Help
Entry
Deima_2644        CDS       T01412                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00900  Terpenoid backbone biosynthesis
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01130  Biosynthesis of antibiotics
Module
dmr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Deima_2644
Enzymes [BR:dmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Deima_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NmrA
Motif
Other DBs
NCBI-ProteinID: ADV68277
UniProt: E8UB38
Position
complement(2829925..2831085)
Genome map
AA seq 386 aa AA seqDB search
MRISILGSTGSIGTQALDVARERGWTVTALAAGRNLDLLEQQVREFSPGVVSVAPEALGA
ARARLGGVRVISDNREIATADADVLVGAMSGLHGLEPTRAALQAGRAVALATKEAMVVAG
HLIWDAAGEGGGRIVPVDSEHTGVYQALTGEHLDDVAEVILTASGGPFREGPEDLSRVTP
EQALRHPNWSMGRKVTLDSATLMNKGLEVMECAGLYGLPLSRVGVLVHPQSVVHALVRYR
DGNLKAQLGPTDMRLAIAYAMDAAPTGMTRPGDVSGARRGAEVHGHLGYHLTGNLSFSDP
DLARFPCLALAYRAGNVGGLAPCALNAADEIAVDAFLDGHIGFLDIPRVIERVLDETPGG
PLSWDAIPDADAWARARARELCRVPA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatctccattctgggcagcaccgggtccatcggcacgcaggcgctcgacgtggcg
cgcgagcgcggctggacggtcacggccctcgccgccggacggaacctcgacctgctcgaa
cagcaggtccgcgaattcagcccgggcgtcgtcagcgtcgccccggaggccctgggtgca
gcgcgtgcccgcctgggtggcgtgcgcgtcatcagcgacaaccgcgagatcgccaccgcc
gacgcggacgtcctcgtgggcgccatgagtggcctgcacggcctggagcccacccgcgcc
gcgctgcaggcgggccgcgccgtcgcgctcgccaccaaggaggccatggtcgtcgccgga
cacctgatctgggacgccgcgggtgagggcgggggccgcatcgtgcctgtggacagcgaa
cacaccggcgtgtaccaggcgctcaccggcgaacacctcgacgacgtcgccgaggtgatc
ctcactgcgagcggcggaccgttccgcgaaggccccgaggacctcagccgcgtgacgccc
gagcaggccctccgacacccgaactggagcatgggccgcaaggtcaccctcgacagcgcc
accctgatgaacaaaggcctggaagtcatggagtgcgccggcctgtacggcctgccgctc
agccgcgtgggcgtgctcgtgcacccacagagcgtcgtgcacgccctcgtgcggtaccgc
gacgggaacctcaaggcgcagctgggcccgaccgacatgcgcctcgccatcgcgtacgcc
atggacgccgcgcccaccggcatgacccgcccgggtgacgtgagcggcgcgcggcgcggc
gcggaagtgcacgggcacctcggctaccacctcaccgggaacctcagcttcagcgacccg
gacctggcgcgcttcccgtgcctcgcgctcgcgtaccgcgcgggcaatgtgggcggcctc
gccccgtgcgccctgaacgccgccgacgagatcgccgtggacgccttcctggacggccac
atcggcttcctggacattccgcgcgtcattgagcgcgtcctcgacgagacgccgggcggg
ccgctcagctgggacgccattcccgacgcggacgcctgggcgcgcgcgcgcgcgcgcgaa
ctgtgccgggtgcctgcatga

DBGET integrated database retrieval system