KEGG   Deinococcus maricopensis: Deima_2675Help
Entry
Deima_2675        CDS       T01412                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00260  Glycine, serine and threonine metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deima_2675
Enzymes [BR:dmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Deima_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADV68307
UniProt: E8UB68
Position
2859921..2860937
Genome map
AA seq 338 aa AA seqDB search
MIVDLRSDTVTTPTPEMRRAMSEAVVGDDVYGEDPTVNELQAEAARTLGFEAALFMPSGS
MTNQVAIAVHTGRGEEVICAEGSHIYEWELGMMAAFSGVVPRFVPAPLGVPDPDDVRLAV
RHSVHQSPSGLISLENTHNKAGGTVIPLNVMHAIRGVADAEGLPLHLDGARVFNAAAALN
VDIAEVVRPFHSVSVCLSKGLGAPVGSVLLGTRDFIRRAHRYRKMLGGGMRQAGILAAAG
LIALREGPARLAEDHRRTRELAVALLDAGYDVNLAAVQTNIIYVNMPEAQLQVGAWEQQG
VRASALGPTSVRFVLHHQITDEHLARAIEVLTKQVPVA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcgacctgcgcagcgatacggtcacgacgcccacgccggagatgcggcgcgcc
atgagcgaggcggtcgtcggcgacgacgtgtacggcgaggacccgaccgtcaacgagctg
caggcggaagcggcgcgcaccctggggttcgaggcggcgctgttcatgccgagcggcagc
atgacgaaccaggtggcaatcgcggtgcacaccgggcgcggcgaggaggtcatctgcgcg
gagggcagccacatctacgagtgggaactcgggatgatggcggcgttcagcggcgtggtg
ccgcgcttcgtgccggcgccgctcggcgtgccggacccggacgacgtgcgcctcgcggtg
cggcacagcgtgcaccagtccccgtcgggcctgatcagcctggagaacacgcacaacaag
gcgggcgggacggtcattccgctgaacgtgatgcacgccattcgcggcgttgcggacgcg
gaggggctgccgctgcacctggacggcgcgcgcgtgttcaacgcggcggcggcgctgaac
gtggacatcgcggaggtcgtgcggccgttccattcggtgagcgtgtgcctcagcaagggg
ctgggcgcgccggtggggagcgtgctgctgggcacgcgcgacttcattcgccgcgcgcac
cgttaccgcaagatgctgggcggcggcatgcgccaggcggggattctcgcggcggcgggc
ctgatcgcgctgcgtgaagggccggcgcggctcgcggaggaccaccgccgcacgcgcgaa
ctggcggtggcgctgctggacgccgggtacgacgtgaacctcgcggcggtgcagacgaac
atcatttacgtgaacatgcctgaagcgcagctgcaggtgggcgcgtgggagcagcagggc
gtgcgggcgagcgcgctcgggccgacgagcgtgcggttcgtgctgcaccaccagattacg
gatgagcacctcgcgcgcgcgattgaggtgctgacgaagcaggtgccggtcgcgtga

DBGET integrated database retrieval system