KEGG   Deinococcus maricopensis: Deima_2684Help
Entry
Deima_2684        CDS       T01412                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00220  Arginine biosynthesis
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01130  Biosynthesis of antibiotics
dmr01230  Biosynthesis of amino acids
Module
dmr_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:dmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Deima_2684
Enzymes [BR:dmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Deima_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Root_cap DUF5500
Motif
Other DBs
NCBI-ProteinID: ADV68315
UniProt: E8UB76
Position
2869240..2870235
Genome map
AA seq 331 aa AA seqDB search
MTRAKKAKAPATPALLTDATLPAPAMAGRDFLSNLDMTPQELRAVLDTAHSMKRGQWRQV
KPLAGLTLALIFEKASLRTRTTFDVGMYQLGGHAITLTNQEIGLGTRERISDVARNLERW
VDGVMGRVYLQQTLQELAQHARIPVINGLSDMLHPVQLLADYQTIEEHLGEVRGKRIVYI
GDGNNLANSHIHMGVLTGADVTIVTPVGYEPNGAVLMDAVKQGARITLTNDLAAVDGADV
LYTDVWISMGQEAEAEHRRRAFRGYQVNAAMLDRIAPNGIFLHCLPAHYGEEVVEEATDH
PKSCVFNQAENRLHAQKALLYHILGGTQPRW
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgccaagaaggccaaagcccccgccacccctgccctcctcacggacgccacc
ctccccgcccccgccatggccggacgcgacttcctgagcaacctcgacatgaccccgcag
gaactgcgcgccgttctcgacaccgcccacagcatgaaacgcggccagtggcgccaggtg
aaacccctcgcgggcctcacgctcgcgctgatcttcgagaaggcctccctgcgcacccgc
accaccttcgacgtcggcatgtaccagctcggcgggcacgccatcaccctcaccaaccag
gaaatcggcctcggcacccgcgaacgcatcagcgacgtcgcccgcaacctcgaacgctgg
gtggacggcgtcatgggccgcgtatacctccagcagaccctgcaggaactcgcgcagcac
gcccgcattcccgtcatcaacggcctgagcgacatgctccaccccgtgcagctcctcgcc
gactaccagaccatcgaggagcacctcggcgaggtgcgcggcaaacgcatcgtgtacatc
ggcgacggcaacaacctcgccaacagccacatccacatgggcgtcctgaccggcgcggac
gtcaccatcgtcacgcccgtcgggtacgaaccgaacggcgccgtcctcatggacgccgtg
aagcagggcgcgcgcatcaccctcacgaacgacctcgccgccgtcgacggcgccgacgtg
ctctacaccgacgtgtggatcagcatggggcaggaagccgaagcagagcaccgccgccgc
gccttccgcggctaccaggtgaacgccgccatgctggaccgcatcgcgccgaacggcatc
ttcctgcactgcctgcccgcgcactacggcgaggaggtcgtcgaggaagccaccgaccac
cccaagagctgcgtgttcaaccaggccgaaaaccgcctgcacgcgcaaaaagcgctgctc
taccacatcctcggcggcacgcagccccgctggtga

DBGET integrated database retrieval system