KEGG   Desulfovibrio marinus: E8L03_10675
Entry
E8L03_10675       CDS       T06743                                 

Definition
(GenBank) xanthine dehydrogenase family protein molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dms  Desulfovibrio marinus
Pathway
dms00230  Purine metabolism
dms01100  Metabolic pathways
dms01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dms00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    E8L03_10675
Enzymes [BR:dms01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     E8L03_10675
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QJT09375
Position
2412059..2414377
AA seq 772 aa
MSAKKATPLYYKATEPFPQAPPPGQAPAPWTKTNVVGKRKPRVDGYERISGAAIYPSDIT
LPDMLYAAPLASPHPNAVLKSLDVSEAETMDGVYAIITPTSPEADIQWAFNDMEVPLLDR
KARYEGWIVGAVAADTPYKAFDAVRASKAEWEVLPFVSDGPDALKAGAPKVHPDGNVVQE
ETYERGDIAAGFSQADTVLELDLMTQTELQTPVELHGCVARWDGDELTIWESTQGVFEVQ
STVAKVLGMPLSRVRVIGHYVGGGFGSKLRTSKYAILAALLAKRANRPVKFFHTREHTFL
DMGTRPASYMHIKAGVKKDGTLTALEFSGIGESGAYPAGGASLLDWQVKDLYTCPNVKTK
LTDTYVNAGPARPFRAPGYPQGNWAMEQMMDALSREIDMDPVDLRLKNIPLVSQARENQP
EYTTTGLKECITKGAEVFGWQEARKRTASQPKEGHLRRGVGMAACNWFIGGGFPPATVVV
KLFADGSVNLNMGASDIGTGTKTIMALVVAEELGVDYDLVQIENADTGTTQFTRPSGGSK
TVPIESPTVRMACIKVKEQLMEMAAEELETTPDKLVFAGKSIHADGDSSKSVDVTALKRL
SGQQVVIGVGHKTSVPQDKAIVPFGAQFCEVEVNTLTGELKLLRFVAAHESGRIMDRLTY
DCQVVGGVAMGIGLGTTEMRVLDRNNTGKLCNKNWHDYKLPTALDMPPEIISEPIEMPDD
QANITGAKGLGEPVTVPTASAIANAVFDAVGVRMLDTPINPTTLAAKIAGKA
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgagcgccaagaaggctactccactatactacaaggccaccgagccgtttccccaggcg
ccgcctccgggccaggccccggctccctggaccaagaccaatgtcgtgggcaagcgcaaa
ccgcgcgtggacggttacgagcgtatcagcggcgccgccatctatccttcggacattacc
ctgccagacatgctgtacgccgcgccgctggccagcccgcatcccaacgccgtgctcaag
agcctggacgtctccgaggccgagacaatggacggcgtctacgcgatcatcaccccaacc
tctccggaggcggatatccagtgggccttcaacgacatggaagtgcccctgctggaccgc
aaggcccgctacgagggctggatcgtaggcgccgtagccgccgatacgccgtacaaagcc
tttgacgcggtgcgcgcttccaaggcggagtgggaggtgctgccctttgtctcggacggc
ccggacgccctcaaggctggcgcgcccaaggtccacccggacggcaacgtggtccaggag
gaaacctacgaacgcggcgacatagccgccggcttttcccaggccgatacggttctggag
ctcgacctgatgacccagaccgagctgcagacgcccgtggagctgcacggctgcgtggcg
cgctgggacggcgacgagctcaccatctgggagtccacccagggcgtcttcgaggtgcag
tccaccgtggccaaggtcctgggcatgccgctctcccgggtgcgggtcatcggccactac
gtgggcggcggcttcggctccaagctgcgcacctccaagtacgccatcctcgccgccctg
ctggccaagcgggccaaccggccggtcaagttcttccacacgcgggagcacaccttcctg
gacatgggcacccgcccggcctcgtacatgcacatcaaggccggcgtgaaaaaggacgga
accctcaccgccctggaattctccggcatcggcgagtccggcgcctacccggccggcggc
gcgagcctgctggattggcaggtcaaggatctctacacctgccccaacgtcaagaccaag
ctcaccgatacatacgtcaacgccggtccggcgcggcccttccgcgcacccggctacccc
cagggcaactgggccatggagcagatgatggacgctctgtcccgcgagatcgacatggac
cccgtggatctgcggctcaaaaacattccgctcgtctcccaggcccgggagaatcagccc
gagtacaccaccaccggcctgaaggagtgcatcaccaagggcgccgaggtctttggctgg
caggaggccagaaagcgcaccgccagccagcccaaggaaggacatctgcgccgcggcgtg
ggcatggccgcctgcaactggttcatcggcggcggctttccaccggccaccgtggtggtc
aagctctttgccgacggctccgtgaacttgaacatgggggcttcggacatcggcaccggc
accaagaccatcatggccctggtggtggcagaggagctgggcgtggactacgatctggtg
cagatcgaaaacgcggataccggcaccacccagttcacgcggccctccggcggttccaag
accgtgcccatcgagtcaccgaccgtgcgcatggcctgcatcaaggtgaaggagcagctc
atggagatggctgccgaggagctggagaccacgccggacaagctggtctttgccggcaag
agcatccacgcggacggcgattcgtccaagtccgtggacgtcaccgcactcaagcgcctc
tctggccagcaggtggtcatcggcgtgggccacaagacgtccgttccgcaggacaaagcc
atcgtccccttcggcgcgcagttctgcgaggtggaggtgaacaccctcaccggtgagctc
aagctcctgcgcttcgtggccgcgcacgagtccggccggatcatggaccgcctgacctac
gactgccaggtggtgggtggcgtggccatgggcatcggcctgggcaccacggagatgcgc
gtgctggaccgtaacaacaccggcaagctctgcaacaagaactggcacgactacaagctg
cccacagccttggacatgccgccggaaatcatctccgagcccatcgagatgcccgacgac
caggccaacatcaccggcgccaaggggcttggcgaacccgttaccgtaccgaccgcctcg
gccatagcaaacgccgtgttcgacgccgtcggcgtgcgcatgctggatacgcccatcaat
ccaacgaccttggcggcgaagatcgccgggaaggcctag

DBGET integrated database retrieval system