KEGG   Desulfitobacterium metallireducens: DESME_11440Help
Entry
DESME_11440       CDS       T03599                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dmt  Desulfitobacterium metallireducens
Pathway
dmt00071  Fatty acid degradation
dmt00280  Valine, leucine and isoleucine degradation
dmt00310  Lysine degradation
dmt00362  Benzoate degradation
dmt00380  Tryptophan metabolism
dmt00620  Pyruvate metabolism
dmt00630  Glyoxylate and dicarboxylate metabolism
dmt00640  Propanoate metabolism
dmt00650  Butanoate metabolism
dmt00720  Carbon fixation pathways in prokaryotes
dmt00900  Terpenoid backbone biosynthesis
dmt01100  Metabolic pathways
dmt01110  Biosynthesis of secondary metabolites
dmt01120  Microbial metabolism in diverse environments
dmt01130  Biosynthesis of antibiotics
dmt01200  Carbon metabolism
dmt01212  Fatty acid metabolism
dmt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DESME_11440
   00630 Glyoxylate and dicarboxylate metabolism
    DESME_11440
   00640 Propanoate metabolism
    DESME_11440
   00650 Butanoate metabolism
    DESME_11440
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DESME_11440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DESME_11440
   00072 Synthesis and degradation of ketone bodies
    DESME_11440
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DESME_11440
   00310 Lysine degradation
    DESME_11440
   00380 Tryptophan metabolism
    DESME_11440
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DESME_11440
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DESME_11440
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DESME_11440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmt04147]
    DESME_11440
Enzymes [BR:dmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DESME_11440
Exosome [BR:dmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DESME_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHF07551
UniProt: W0EEP0
Position
2237601..2238779
Genome map
AA seq 392 aa AA seqDB search
MQEVVIVSAQRTPIGDYLGALKEVSAIELGVIALKAALEKATIDASQIEEVVAGNVFQAG
LKGNPARQVALKAGCSMETVAVTINQLCPSSMRATEILSQEIALGKVDIGAAVGMESMSN
IPYLLPKVRSGYRMGNNEVLDAMLHDGLFDAFYDYHMGMTAENLAEQYEISREEQDELSY
LSHQRALQAIQTGKFKEEIVPVEFKTKNGTVVIDTDEHPNAKTSPEILAKLKPAFKKNGT
VTAGNSSGLNDGGSALILMSAKKAVELGIKPLAKILSTASAAVDPKIMGIGVVPAVKRAL
KFAQLSLEDIDYWELNEAFAAQFLAVNREFKLSMEKVNVNGSGISLGHPVGNSGARLIVS
LLYEMRRRGARYGCASLCAGGGPAVATVVELL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaggttgtcattgtaagtgctcagcgtaccccaattggagattatctgggtgct
ttaaaagaggtttcagcgattgagcttggggtgatcgctttaaaagcagcgcttgaaaaa
gcaaccatagatgcttctcagattgaagaagtggtggcaggtaatgtttttcaggccggg
ttaaagggaaacccagcacgtcaagttgctctaaaagcgggttgttccatggaaacagta
gctgttacgattaatcaattatgcccttcatccatgcgtgctacggaaattctcagtcag
gagatcgccttgggcaaggtggatattggtgctgcagtcggtatggaaagcatgtcaaac
attccctatcttttaccgaaggtccggagcggctatcgaatggggaataatgaagtcctg
gatgccatgttgcatgatggcttgtttgacgcattctatgactatcatatgggcatgaca
gcagaaaacttagcagagcagtatgaaatttcccgtgaggaacaggacgagttgtcatac
ttaagtcatcaaagagcactgcaggcaatacaaacaggaaaattcaaggaagaaatcgtc
cctgttgaattcaagaccaaaaatggaaccgtagtaattgataccgatgagcatcctaac
gctaaaacgagtcctgagatcttagcaaagctgaaacctgctttcaagaaaaatggaacc
gtaaccgcaggaaactcgtccggcctcaatgatgggggctcagcattaatcttaatgtca
gcgaaaaaggcagtcgagcttgggattaagcctttagccaaaatcctttccaccgcatcc
gctgcagtggatcctaagattatggggatcggcgttgtccccgccgtgaagagagcttta
aagtttgctcaattaagtctggaagatattgattattgggaactgaatgaagcctttgct
gcccaatttctggcggttaaccgtgaatttaaactgagtatggagaaagtgaatgtgaat
ggttcaggcatttccttggggcatcctgttggaaattctggagctcgtttaattgtctct
ctattgtatgaaatgcggcgtcgtggagcgcgctacggctgtgcctccctttgtgctggt
ggtggacctgccgttgctaccgtggttgaacttctttag

DBGET integrated database retrieval system