KEGG   Desulfitobacterium metallireducens: DESME_12525Help
Entry
DESME_12525       CDS       T03599                                 

Definition
(GenBank) segregation protein B
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
dmt  Desulfitobacterium metallireducens
Pathway
dmt00450  Selenocompound metabolism
dmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DESME_12525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dmt03016]
    DESME_12525
Enzymes [BR:dmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     DESME_12525
Transfer RNA biogenesis [BR:dmt03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    DESME_12525
 Prokaryotic Type
    DESME_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS HD_5
Motif
Other DBs
NCBI-ProteinID: AHF07753
UniProt: W0EE22
Position
complement(2465138..2466106)
Genome map
AA seq 322 aa AA seqDB search
MRHIPKNVKDANLIVGIDTNDDAGVYKLNEEQAIVQTADFFTPVVDDPYSFGMIAAANAL
SDIYAMGAKPLTAMNLVAFPIKELDKSILAQILQGGYDKIREAGAILLGGHSIDDQEPKY
GLSVTGIVHPQQVLSNAKAQVGDYIVLTKPLGIGIITTGIKRGLVSVEGEQEVIRVMAEL
NKSASEAAIEANVSSVTDITGFGLLGHLHEMMKGSGVEAQLQAQKIPILEATWDCLKKKA
IPGGSLANREFLADKVVFDKEISEELQLVLCDAQTSGGLLISVPAERLEVLLESLRKHKT
LVSAVIGQVGLGEPGLIKVAMN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcatataccgaaaaacgttaaagatgctaatctaattgttggaattgataccaat
gatgatgcaggggtttataagttaaatgaggaacaggcgattgttcaaactgcagatttc
tttactccagtcgtcgatgacccatactcgtttggaatgattgcagcggctaatgctttg
agcgatatctacgcgatgggagcaaaacccttaacggcaatgaatctcgttgcttttccg
atcaaggaattagataaatcgattcttgcacagattttgcagggaggttacgataaaatc
cgcgaagcaggtgccattctgctggggggacattcgatcgatgatcaagagcctaaatac
gggctttcagttacaggaatcgtccatccgcaacaggtgctatccaatgccaaagcccaa
gtgggtgattatattgtgcttactaagcctttggggatcggaattattacgacgggtatc
aaacggggtttagtctctgttgaaggtgagcaagaagttattcgcgtgatggctgagcta
aataaatccgcttctgaagcggcgatcgaggctaacgtgagttcggtaaccgatatcaca
ggttttgggttgttaggacaccttcatgaaatgatgaaggggagtggcgtcgaagctcag
cttcaagcgcagaaaatacctatccttgaagcgacttgggattgcctgaagaaaaaagcg
attcctggagggtctcttgcgaatcgagagttccttgcggataaagtggtatttgacaaa
gagatatctgaggaactacagcttgtattatgtgatgcccaaacctcgggcgggttgttg
atctctgtgccggcggaacggttagaggttttactggaatctctgagaaaacataagact
cttgtatcagctgttatcgggcaagttgggttgggtgaaccggggttaatcaaggtcgct
atgaattaa

DBGET integrated database retrieval system