KEGG   Desulfurococcus mucosus: Desmu_0331Help
Entry
Desmu_0331        CDS       T01406                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00010  Glycolysis / Gluconeogenesis
dmu00020  Citrate cycle (TCA cycle)
dmu00620  Pyruvate metabolism
dmu00640  Propanoate metabolism
dmu00650  Butanoate metabolism
dmu00680  Methane metabolism
dmu00720  Carbon fixation pathways in prokaryotes
dmu01100  Metabolic pathways
dmu01120  Microbial metabolism in diverse environments
dmu01130  Biosynthesis of antibiotics
dmu01200  Carbon metabolism
Module
dmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_0331
   00020 Citrate cycle (TCA cycle)
    Desmu_0331
   00620 Pyruvate metabolism
    Desmu_0331
   00640 Propanoate metabolism
    Desmu_0331
   00650 Butanoate metabolism
    Desmu_0331
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desmu_0331
   00680 Methane metabolism
    Desmu_0331
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desmu_0331
Enzymes [BR:dmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desmu_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C SAT
Motif
Other DBs
NCBI-ProteinID: ADV64650
UniProt: E8R824
Position
316788..318047
Genome map
AA seq 419 aa AA seqDB search
MEKTALKPKIPLEKQVLMTVNGDEAVAYAVKQSYVDVVAAYPITPQTIIVEKYSEFVNDG
LVHTEFVPVESEHSAMSACVGAAAAGARAFTATSSQGLALMVEIVYIASAMRLPIVMAVV
NRALSAPINIHNDHSDAYLMRDSGWIQLFVENVQEAYDTTIQAFKIAEDPRVQLPVAVNL
DGFFLSHTLEEVYMLPDDEVYGFLGGPRKTVNVKVDYFEEEVPFTLNPARPISLGSLDLY
DYYFEHKVQQVEAMKAVPQVVREVNEEWYRLTGRRYGDGVLRAHWVDDADIVVVAMGSGA
GTVRSVVRKLREKGERIGLLQLRMFRPFPYSEVAEKLSGAKLVVVMDKAIGPGAFGALYE
DVAVSLYDSGERPMLVDYIYGLGGRDLQPSLVYKMIEEAKRDLEAKRVERKIRYLGVRE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaccgcgttgaaacccaagatcccgcttgagaaacaggttttaatgaccgtt
aacggggatgaggcagtagcctacgcagtgaagcagagctatgtcgacgtggttgcagcc
tacccgataacgcctcagaccataatagttgaaaagtactctgagttcgtgaacgatggc
ttagtgcacacggagttcgtcccagttgaatcagagcactcagcgatgagcgcgtgcgtg
ggtgcagccgcagcgggagccagggctttcacagccacatcctcgcaggggcttgcatta
atggttgaaatagtctacatagcatcggcgatgaggctcccaatagtcatggccgtggtt
aacagggctctctcagcccccataaacatacataatgatcacagcgacgcatacctgatg
agggactctgggtggatacagctgttcgtcgagaacgtgcaggaggcctacgatacaaca
atacaggccttcaagatagctgaggatccaagggtgcagctaccggttgcagtgaacctc
gacgggttcttcctgagccacacgcttgaggaggtatacatgttgcccgacgacgaggtc
tacggcttcctcggcggaccaagaaagacagtcaacgtgaaagtggattacttcgaggaa
gaagtaccattcaccctgaacccagcgaggccgatatcacttggatcactagacctctac
gactactacttcgagcacaaggttcaacaggtggaggcgatgaaagccgtcccacaggtt
gtaagagaagttaacgaggaatggtacaggctgacaggtaggagatatggtgatggagtg
ctgcgggcacactgggttgacgacgcagacatagtggtggtggcaatgggcagcggggcc
ggcactgttagaagcgttgtgaggaagctgagggagaaaggggagagaataggcctcctc
cagctaaggatgttcaggcccttcccctacagtgaggtagcggagaagctctcaggcgca
aagcttgtagtggtgatggataaggcgataggtcccggcgccttcggcgccctctacgag
gacgtggcggtgagcctctatgattcaggtgagagacccatgctcgtcgactacatctat
ggtctaggcggcagggatctacagccctcactggtctacaagatgatagaggaggctaag
agggatctcgaggctaagcgcgtcgagaggaagataaggtacttaggggtgagggagtag

DBGET integrated database retrieval system