KEGG   Desulfurococcus mucosus: Desmu_0391Help
Entry
Desmu_0391        CDS       T01406                                 

Definition
(GenBank) Glycosyl transferase, family 4, conserved region
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dmu01003]
    Desmu_0391
Enzymes [BR:dmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     Desmu_0391
Glycosyltransferases [BR:dmu01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Desmu_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-ProteinID: ADV64710
UniProt: E8R884
Position
381436..382452
Genome map
AA seq 338 aa AA seqDB search
MSQGAMADALGYLVPVAVSAATAWLLLDWWVDAGWRLGLKGRDMNKPGEHYAVEAGGVWV
LLGAAFGILSYVALDTYLSSDKGSVEYFAVSQVLVLAGLLGLMDDILGWKKGLSQVKRVL
LTLPISFPLVVVKAGYTSVELPLIGVLDLGPLYPLLVVPVGVMGASNAFNMIAGYNGLEA
LQALVITGFTLLFALKKGIVDVIPLLLVMAAAILVFLRYNWCPARVFPGNTFTYGFGAFY
ASIVIYGNFEKFGLALFTPYFIELALFIRGLLNGVYKENFSKPTPEGCLKPPYSKHYSLT
HLAITVVEKLKGCAGERSVVVFITLIEAAAATVALILL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagggagcgatggctgatgcactgggatacctggtccctgtagcagtatcggct
gcaacagcctggctcctcctggactggtgggttgacgccgggtggaggctggggctcaag
ggcagggatatgaataagccgggcgaacactacgctgtggaggcgggcggcgtatgggtc
ctcctaggggctgcattcggcatcctctcatacgtcgcgctcgacacatatctctcaagt
gataaggggagcgtggagtacttcgctgtctcccaggtcctcgtcctcgcaggcctccta
gggttaatggatgacatactcggctggaagaaggggttgagccaggttaaaagagtattg
ttaacgctgcccatatccttcccgctcgtagtggtgaaagccggctacactagtgtcgaa
ctccccttgataggggtcctcgacctaggccccttatacccgctgctggttgtcccagtc
ggcgtgatgggggctagcaacgcgttcaacatgatcgccgggtacaatgggcttgaagca
ctccaggcactggttatcacggggttcaccctgctgttcgccttgaagaagggtatagtg
gatgtaatccccctgctcctcgtgatggctgctgcaatcctagtcttcctaaggtacaac
tggtgtcctgcaagggttttccccggtaacaccttcacctacgggttcggcgccttctat
gcttcaatagtgatatacggtaacttcgagaagttcgggctagccttgttcacaccctac
ttcattgagctagcgttattcataaggggcctgttaaacggcgtgtacaaggagaacttc
agtaagccgacccccgaggggtgtttgaagccgccttacagtaagcactatagtttaacc
cacctagcgatcaccgtggttgagaagctgaagggatgcgccggggagaggagcgtggtc
gtattcataacgctgatcgaggcggctgcagccaccgtggcattaatactactgtag

DBGET integrated database retrieval system